. . . . . . . . . . . "Hyperspectral image (HSI) analysis plays a central role in remote sensing tasks requiring fine-grained material discrimination, vegetation health assessment, and post-disturbance monitoring. Yet, the high dimensionality and strong spectral redundancy in HSIs often reduce the efficiency and reliability of machine learning models. These challenges are especially important in wildfire science and prescribed-fire monitoring, where spectral responses vary due to burn severity, char deposition, canopy structure, and early vegetation recovery. Benchmark datasets such as Indian Pines and Pavia University and others provide controlled environments for algorithms’ evaluation, but real-world post-fire forest conditions pose additional complexity. This study presents a unified and comprehensive evaluation of five dimensionality reduction strategies: Principal Component Analysis (PCA), Spatial–Spectral Edge Preservation (SSEP), Spectral-Redundancy Penalized Attention (SRPA), and a Deep Reinforcement Learning (DRL)-based selector together with a clustering based baseline, K-Means Clustering-Based Band Selection (KMCBS). These strategies are combined with classical machine learning and deep learning classifiers: Random Forest (RF), Support Vector Machines (SVMs), K-Nearest Neighbors (KNNs), and 3D Convolutional Neural Networks (3D-CNN). The full pipeline includes exploratory data analysis, preprocessing, patch-based spatial–spectral modeling, consistent train–validation protocols, and multi-dataset evaluation across Indian Pines, Pavia University, and a new custom VNIR hyperspectral dataset collected after prescribed burns at the Lubrecht Experimental Forest in Montana, USA. By systematically comparing statistical, edge-aware, attention-guided, and reinforcement learning-based band-selection strategies, this work identifies compact yet informative spectral subsets that enhance classification performance while reducing computational cost. Importantly, the inclusion of the Montana prescribed-burn dataset provides a unique real-world testbed for understanding band selection behavior in fire-affected forest environments. Overall, this study contributes a generalizable and extensible framework for HSI dimensionality reduction and classification, laying the groundwork for future applications in wildfire assessment, vegetation recovery monitoring, and remote sensing.\r\nKeywords: hyperspectral imaging; band selection; machine learning; prescribed fire" . "Hyperspectral Band Selection for Ground Fuel Classification for Prescribed Fires" . . . "mahmadisaq.karankot@student.montana.edu" . "6 May 2026" . "2024" . . "Emily Regalado" . "2026-06-10T23:35:09.523Z"^^ . . . . . . . . . "RSA" . "MIIBIjANBgkqhkiG9w0BAQEFAAOCAQ8AMIIBCgKCAQEAxzr6UBGMW6c8tegz0babaledWUEQ0PLDE4tp7Iinbe2DZtAtY5JUptKYuStWDZx+QER4808P8dejNWRnBDzgthYJm/AyNSXflHSJhz2+NC+h7RylOLxbwLEQocmyKKiYxa2gT85m6ajVL2M6TnfG67nnK+K2f7iCGL6wYXRITD1q+7+5SWqBdDXIV921W4IKWaD2GJk+NRBoOqQhbsrk8Tn5XsNd7DMYVHk47oMDGbeBnrOIoRPsbBgAcoCsxxhiB9yN6Lf8EUbnlXVEDzJuZk048L1BDZL+6nkA8btTQGP2ijUFWA7rTrod3LjUDQWLZS95njjl867dtmv/znYkzwIDAQAB" . "K/xYA1SrC52nHlzvkEuSJoe/3GyLE1rb48fam3J4Kajpzf0KVXB5DNi7KZixRV7JkNfvD44a0evbRqFjPHWAXVUVFuUv12ZTmCmgAqJK126aQeOuyfsc2f8Vn8rBwiny3LhLsEWI3roxBndXPHxL1sMjAg5YM+vvEc33zmFN7mYba8UgRYLdfSIksgkwJpYpOaTFrW531tDE6UfYZrDVz2VxrIQzzufJt8nFeBL2sFSogHG0PQH2aeDjWAoyolKa07DD28dFa2O1zSftkSNUtyohZXL6C5w9EcQXh6DALPEa1FIju3vQvpZC58zbe6j8VrsrXVCgzF2KGnoCgjys4Q==" . . . . . . . . . . . . . . "Finding potential research collaborators is a challenging task, especially in today’s fast-growing, interdisciplinary research landscape. While traditional methods rely on observable ties like co-authorships and citations, we focus solely on publication content to build a topic-based research network using BERTopic with a fine-tuned SciBERT model that connects and recommends researchers across disciplines based on shared topical interests. A key challenge we address is publication imbalance, where some researchers publish much more than others, often across several topics. Without careful handling, their less frequent interests are hidden under dominant topics, limiting the network’s ability to capture their full research scope. To tackle this, we introduce a cloning strategy that clusters a researcher’s publications and treats each cluster as a separate node. This allows researchers to belong to multiple communities, improving the detection of interdisciplinary links. Evaluation shows that the cloned network leads to more meaningful communities and uncovers broader collaboration opportunities." . "Handling Publication Imbalance for Effective Community Detection in Scholarly Networks" . . . "mdasaduzzamannoor@montana.edu" . "Feburary 3 2026" . "2024" . . "Emily Regalado" . "2026-06-10T23:15:00.829Z"^^ . . . . . . . . . "RSA" . "MIIBIjANBgkqhkiG9w0BAQEFAAOCAQ8AMIIBCgKCAQEAxzr6UBGMW6c8tegz0babaledWUEQ0PLDE4tp7Iinbe2DZtAtY5JUptKYuStWDZx+QER4808P8dejNWRnBDzgthYJm/AyNSXflHSJhz2+NC+h7RylOLxbwLEQocmyKKiYxa2gT85m6ajVL2M6TnfG67nnK+K2f7iCGL6wYXRITD1q+7+5SWqBdDXIV921W4IKWaD2GJk+NRBoOqQhbsrk8Tn5XsNd7DMYVHk47oMDGbeBnrOIoRPsbBgAcoCsxxhiB9yN6Lf8EUbnlXVEDzJuZk048L1BDZL+6nkA8btTQGP2ijUFWA7rTrod3LjUDQWLZS95njjl867dtmv/znYkzwIDAQAB" . "gTot6dYxs8/0kOAQqWjHMn1Y1jY1fPBQ/JZM/F8P7Tq4974cV6PbClrG/8A2+sAJvYHTT1kJJ/7lJxKf1DmLoY/B22BSqyNWSD+uMtCVaWm74xHdM5fgl9FOmU9cO3rLWrroX/INRQJASOgjmTstImuC5kovDnG2m4nR0NBv1QZtnvI0DH/G8b3aGebCqZzf2L2hpRCqC8mYZ6vTCv/ADXUWQJbZZpUR6M+LJyfoxHHQpGfjKL7CGeoTIE3egV02DPhRWWuSzIsOREdlpipdUyHDXM6NdtQsF3aqUwYC9WsKWpg3Ea93cP2aNK1V2u1RJ9Y54z4EMzhj8tdY1NOkNw==" . . . . . . . . . . . . . . . "Many resources and professionals reference the 3-2-1 backup rule as an effective strategy to prevent active research data loss. However, the changes in storage technology and the pace of research data growth have outgrown the 3-2-1 rule. Objectives: The authors want to contribute background information and invite community input to evolve the 3-2-1 rule to fit modern research data and storage better. This evolution would provide better information to research data management professionals and researchers for more resilient research data. Methods: The authors facilitated a workshop at the Research Data Access and Preservation (RDAP) Summit in 2025 to present the necessary information for understanding the current storage and backup landscape. Backups were reframed as failure modes for data loss and corresponding preventative data protection measures. Results: The workshop resulted in an overview and summary of data protection methods and the ways in which they mitigate different “failures,” which allows for a more nuanced discussion of data protection that is not enabled by use of the 3-2-1 rule nor the term “backup” alone. Workshop participants brainstormed ways that the information presented in the workshop could be synthesized and incorporated into various learning materials, including materials for data professionals and researchers." . "Evolving the 3-2-1 backup rule for more resilient data" . . . "dmccaffrey@starfishstorage.com" . "January 2026" . "2025" . . "Emily Regalado" . "2026-06-10T23:02:00.682Z"^^ . . . . . . . . . "RSA" . "MIIBIjANBgkqhkiG9w0BAQEFAAOCAQ8AMIIBCgKCAQEAxzr6UBGMW6c8tegz0babaledWUEQ0PLDE4tp7Iinbe2DZtAtY5JUptKYuStWDZx+QER4808P8dejNWRnBDzgthYJm/AyNSXflHSJhz2+NC+h7RylOLxbwLEQocmyKKiYxa2gT85m6ajVL2M6TnfG67nnK+K2f7iCGL6wYXRITD1q+7+5SWqBdDXIV921W4IKWaD2GJk+NRBoOqQhbsrk8Tn5XsNd7DMYVHk47oMDGbeBnrOIoRPsbBgAcoCsxxhiB9yN6Lf8EUbnlXVEDzJuZk048L1BDZL+6nkA8btTQGP2ijUFWA7rTrod3LjUDQWLZS95njjl867dtmv/znYkzwIDAQAB" . "J8FykTJ8CdpjixvP8F3f3UibzF8cEvFWpvfYz6vrqmogaHw70ukzFlWFnhOxIZx4vGPdFkc9hGF5JqoJpIIOPVrtNRjFZPZoaLBiqWcnAI7mTrGzIWDO1gsjLuyowv5nd3yAotzyenq+z5x5I20A1lVFA+lRAU9DQRjICq+Il7jzxNTQW3zR+N7UMeA5VAp+FUB+Ft7qNyUjO+Glft7u0aBJ6Ds0MzCokXSjP2U8k8mYOG3IUwfNBiCICKiLGLBzZGDgCdzHHDi7l+62R/nwF4uQe6FfZdiiGzjcTiipwwBs9FZg+3EIG5xoOM1YLfew+JXa+VrxMUSzuwVbTGyNRw==" . . . . . . . . . . . . . "This Project generated data in the proces of replication of Weber et al 2025, paper validated on UK Biobank subset of 15000people, by reuse of MIMIC-IV-ECG Physionet clinical dataset, on close to 300000 records, in creation of ECG-extracted enriched cluster biomarkers acting as autonomic profiles for estimation of depression severity and potential suicide risk." . "FAIR Mind" . . . "micu@3ega.nl" . . "Milena Cukic Radenkovic" . "2026-06-05T07:53:19.605Z"^^ . . . . . . . . . . . "RSA" . "MIGfMA0GCSqGSIb3DQEBAQUAA4GNADCBiQKBgQCDtRJBv8cAYP6p1DKehEmWQ0QLnfcZm9UspO+MJoPHRVcFgs9CqLdMh+eL0wcNPWexAUcctogH1Gdi3W2M3+BHEEV0nJwpsmq68Z6Pbg1H4Q4lWyLuWlfg5qOUz7uO+UZRdaET9oQXkFSS408Jk3aZvVys9O52yi/ftbC3xcgqLwIDAQAB" . "Kk2ACumxmtiw1zQmGiocaNU1sLXAUVOlnC2Cop9GfPoaqfKAKNSdJTHgL9Zhmou4POp5u8LHmqJykHXKNJSUtYXoIMu3p82RcUAKTy6LiROQuQFZsYAM3P7IRoptBzJGrV20mJ7JVGDwXu2KJ3/bmEX3U1P0juOfxkph0yCZcnc=" . . . . . . . . . . . . . . . "his paper describes the use of dynamic focus control in a coherent lidar and compares the theoretical and experimental results. The system uses a MEMS variable-focus mirror, which has an electrostatically driven deformable membrane with a diameter of 4 mm and a manufacturer’s published 10%-to-90% rise time of less than 200 µs. The device permits fast, intra-scan adjustment of the downrange beam focus from 2.2 m to infinity for a lidar with a 25 mm diameter exit pupil. Experimentally, the variable-focus mirror improved the signal strength by more than 20 dB for objects within the first Rayleigh distance, in good agreement with theory. The fast response time allows the system to dynamically adjust the focus to different distances within a single sweep of a raster scan, in order to match the system focus on-the-fly to targets at different distances. Three-dimensional point clouds show that this technique allows some targets that are below the noise level when using a fixed focus to become visible when the focus is changed dynamically." . "Dynamic focusing using a MEMS mirror in a coherent lidar" . . . "drandrewoliver@ieee.org" . "April 24 2025" . "2024" . . "Emily Regalado" . "2026-06-03T16:40:26.652Z"^^ . . . . . . . . . "RSA" . "MIIBIjANBgkqhkiG9w0BAQEFAAOCAQ8AMIIBCgKCAQEAxzr6UBGMW6c8tegz0babaledWUEQ0PLDE4tp7Iinbe2DZtAtY5JUptKYuStWDZx+QER4808P8dejNWRnBDzgthYJm/AyNSXflHSJhz2+NC+h7RylOLxbwLEQocmyKKiYxa2gT85m6ajVL2M6TnfG67nnK+K2f7iCGL6wYXRITD1q+7+5SWqBdDXIV921W4IKWaD2GJk+NRBoOqQhbsrk8Tn5XsNd7DMYVHk47oMDGbeBnrOIoRPsbBgAcoCsxxhiB9yN6Lf8EUbnlXVEDzJuZk048L1BDZL+6nkA8btTQGP2ijUFWA7rTrod3LjUDQWLZS95njjl867dtmv/znYkzwIDAQAB" . "NaxVD34QrX62+qzhaqUGYAwoAzcyCARwA6B4ZiJkICrq+QFY3pWcxB6yai6mhm+Rq5Pnbx2f6N4ED2NxtBSpLF12Wx0dEMNBgGgsGiRBtICrrBzgEoXOhR2QVnaKU0PHZ/rMXbuaYj229J6/oJaAQRmGF5DuWRoTyyq6ZPqOaXufpdeFxMr0cZxEBd+zRg7h6fN0sOO3zI7eoTJa6tCZdsUKpUCY9cbbXxS2CQBSyAR1ilvSaQWmtSvZTBGyC6y7RjaR7ZJ9IF4efpPG0wThYgGHB5lz6ouHYvVvR/iyMRYKxf/8igKokdhfFfh8ZRPOvCjweLpEMu8VpdDHLC/E2g==" . . . . . . . . . . . . . . . . . . . "Computational prediction of AgMata aggregation propensity score (0.7004717948717948, unitless) for SARS-CoV-2 Spike RBD variant Alpha (N169Y) using the Bio2Byte AgMata predictor. Sequence-derived: one FDO per variant." . "Alpha AgMata = 0.7004717948717948 — Bio2Byte" . . "0.7004717948717948"^^ . . . "e.a.schultes@lacdr.leidenuniv.nl" . . "2026-06-01T10:30:42Z"^^ . . . . . "Alpha AgMata = 0.7004717948717948 — Bio2Byte" . . . . . . . "RSA" . "MIGfMA0GCSqGSIb3DQEBAQUAA4GNADCBiQKBgQD3w/IUb755GIzp3ueODYkgELhyq4Clygb5Kspge50xo+n8uC/IvXwi+ukRjEpdfX/JZ09yKUCJ2AMMr/QchrsP1Xhg9Q3fEZ4E12XqFd5jX00Qs0K5XZwjBaV8NdDTJW9I4gpcyh0cry7hSBAWHkXEkqbK+lQvR4UFAKejFq6u/wIDAQAB" . "o/5D4I1Do21wi8xjI9qBJkG9whMQFTe4XQHuhfr6ZZlMmsTk9DuHBVWaC1nJ5ExO54Nbrodu+3PDw6X0/X3/7UeJVXG6Ypaf6NosdXQiHUJmMJc9Milq21gnYOEa8VkKRCjuMJwiNgOV2yMGUtvh/+zwNm1jJYj5De522Mz/0v4=" . . . . . . . . . . . . . . . . "Deep mutational scanning measurements (Bloom Lab) for SARS-CoV-2 Spike RBD variant Alpha (N169Y). Six values: bind=9.81374, delta_bind=1.04213, expr=10.05266, delta_expr=-0.13322, confidence_bind=0.0732354593527125, confidence_expr=0.0713853600674372. All unitless." . "Alpha DMS observation — Bloom Lab (bind=9.81374, expr=10.05266)" . . "9.81374"^^ . "0.0732354593527125"^^ . "0.0713853600674372"^^ . "1.04213"^^ . "-0.13322"^^ . . "10.05266"^^ . . "e.a.schultes@lacdr.leidenuniv.nl" . . "2026-06-01T10:30:42Z"^^ . . . . . "Alpha DMS observation — Bloom Lab (bind=9.81374, expr=10.05266)" . . . . . . . "RSA" . "MIGfMA0GCSqGSIb3DQEBAQUAA4GNADCBiQKBgQD3w/IUb755GIzp3ueODYkgELhyq4Clygb5Kspge50xo+n8uC/IvXwi+ukRjEpdfX/JZ09yKUCJ2AMMr/QchrsP1Xhg9Q3fEZ4E12XqFd5jX00Qs0K5XZwjBaV8NdDTJW9I4gpcyh0cry7hSBAWHkXEkqbK+lQvR4UFAKejFq6u/wIDAQAB" . "Bl13byiuVUKGhrm4DD6jsIfDsqOANn+s63Fa512BiLqHAcJACOyxuzD6TfIE+Oaq5/nmzJ3O7R5/JKCoZJmwyY+RSyC5aRAdx8DS/5oPLjpYhXGNDjiiv9ahs69WASGvZBYb39mqkxftuba2crm5hhp0NpbiwGIaS5+uZGNY06w=" . . . . . . . . . . . . . . . . . . . "Computational prediction of RMSD (13.378861773140596 Angstroms) for SARS-CoV-2 Spike RBD variant Alpha (N169Y) using ESM2." . "Alpha RMSD = 13.378861773140596 Å — ESM2" . . . "13.378861773140596"^^ . . "e.a.schultes@lacdr.leidenuniv.nl" . . "2026-06-01T10:30:42Z"^^ . . . . . "Alpha RMSD = 13.378861773140596 Å — ESM2" . . . . . . . "RSA" . "MIGfMA0GCSqGSIb3DQEBAQUAA4GNADCBiQKBgQD3w/IUb755GIzp3ueODYkgELhyq4Clygb5Kspge50xo+n8uC/IvXwi+ukRjEpdfX/JZ09yKUCJ2AMMr/QchrsP1Xhg9Q3fEZ4E12XqFd5jX00Qs0K5XZwjBaV8NdDTJW9I4gpcyh0cry7hSBAWHkXEkqbK+lQvR4UFAKejFq6u/wIDAQAB" . "TzaHIrV+JsLIiMMHDPKKgnTmx/AxjUfxhajeAJhZZiGEdn901oQ5g7cKfNpfCg5Zw5qSfU/1FIqvXgtJa0l28lCwPYfbHZG/lTY7i66vKd33jB8ZmDMAATwG1Hxcttv1pcANULc1S3bgPzztNVgM51SQbQUcPf9SWcVdttakq6E=" . . . . . . . . . . . . . . . . . . . "Computational prediction of RMSD (2.277628683231952 Angstroms) for SARS-CoV-2 Spike RBD variant Alpha (N169Y) using AlphaFold 2." . "Alpha RMSD = 2.277628683231952 Å — AlphaFold 2" . . . "2.277628683231952"^^ . . "e.a.schultes@lacdr.leidenuniv.nl" . . "2026-06-01T10:30:42Z"^^ . . . . . "Alpha RMSD = 2.277628683231952 Å — AlphaFold 2" . . . . . . . "RSA" . "MIGfMA0GCSqGSIb3DQEBAQUAA4GNADCBiQKBgQD3w/IUb755GIzp3ueODYkgELhyq4Clygb5Kspge50xo+n8uC/IvXwi+ukRjEpdfX/JZ09yKUCJ2AMMr/QchrsP1Xhg9Q3fEZ4E12XqFd5jX00Qs0K5XZwjBaV8NdDTJW9I4gpcyh0cry7hSBAWHkXEkqbK+lQvR4UFAKejFq6u/wIDAQAB" . "jm0TI7iEB2VVqYxKFPBvlqCaU8GqQvR683OokWcupgvf2ng96n9QYF+iJtnYUOj8zNG60rOhAZ1cNJO+RvrK9Q9c2R+9Z+5J4V2VRsdB792oPBOQY8+XbSCVESS6rBLXfC3XwHc3kfHWMV8KIrU0NZox47diFREVo+wjg00PKpM=" . . . . . . . . . . . . . . . . . . . "Computational prediction of SASA (10141.236988525969 square Angstroms) for SARS-CoV-2 Spike RBD variant Alpha (N169Y) using AlphaFold 2." . "Alpha SASA = 10141.236988525969 Ų — AlphaFold 2" . . . "10141.236988525969"^^ . . "e.a.schultes@lacdr.leidenuniv.nl" . . "2026-06-01T10:30:42Z"^^ . . . . . "Alpha SASA = 10141.236988525969 Ų — AlphaFold 2" . . . . . . . "RSA" . "MIGfMA0GCSqGSIb3DQEBAQUAA4GNADCBiQKBgQD3w/IUb755GIzp3ueODYkgELhyq4Clygb5Kspge50xo+n8uC/IvXwi+ukRjEpdfX/JZ09yKUCJ2AMMr/QchrsP1Xhg9Q3fEZ4E12XqFd5jX00Qs0K5XZwjBaV8NdDTJW9I4gpcyh0cry7hSBAWHkXEkqbK+lQvR4UFAKejFq6u/wIDAQAB" . "Zb2wG0J1buUOR5a2j7O7YSv0uj3H262qe2RXtW/VlPBMlPe88pAlEHuiYLizTxShKata/gPIaR2tgl0nd3jebN7b+JfnGkvRq5xp0w+Zj9Xh6maLypLzZ56FX9cmQenlVb9j9PfyHoS9wqqWIPdHx6uHeLl0UUFHtfV02Q5JGT8=" . . . . . . . . . . . . . . . . . . . "Computational prediction of SASA (16494.878394358453 square Angstroms) for SARS-CoV-2 Spike RBD variant Alpha (N169Y) using ESM2." . "Alpha SASA = 16494.878394358453 Ų — ESM2" . . . "16494.878394358453"^^ . . "e.a.schultes@lacdr.leidenuniv.nl" . . "2026-06-01T10:30:42Z"^^ . . . . . "Alpha SASA = 16494.878394358453 Ų — ESM2" . . . . . . . "RSA" . "MIGfMA0GCSqGSIb3DQEBAQUAA4GNADCBiQKBgQD3w/IUb755GIzp3ueODYkgELhyq4Clygb5Kspge50xo+n8uC/IvXwi+ukRjEpdfX/JZ09yKUCJ2AMMr/QchrsP1Xhg9Q3fEZ4E12XqFd5jX00Qs0K5XZwjBaV8NdDTJW9I4gpcyh0cry7hSBAWHkXEkqbK+lQvR4UFAKejFq6u/wIDAQAB" . "bJY1wa4DgCkXiGGKMKK/nlmw1E4K6upQJcJNvwr7ZoDqql7reMIRJA+ZNtL3GQuUozlzO49UeRQGDsh9vZneq9Z7Jn1IfOP3SbwUBerPdhbCllQbzsb4ULj1S3ugU5KD51jID/jTHo5//M5iLqcIcS6qTzyli+HdWPkZHKwY3lI=" . . . . . . . . . . . . . . . . . . . "Computational prediction of pLDDT (23.673561732385306 unitless, 0-100) for SARS-CoV-2 Spike RBD variant Alpha (N169Y) using ESM2." . "Alpha pLDDT = 23.673561732385306 — ESM2" . . . "23.673561732385306"^^ . . "e.a.schultes@lacdr.leidenuniv.nl" . . "2026-06-01T10:30:42Z"^^ . . . . . "Alpha pLDDT = 23.673561732385306 — ESM2" . . . . . . . "RSA" . "MIGfMA0GCSqGSIb3DQEBAQUAA4GNADCBiQKBgQD3w/IUb755GIzp3ueODYkgELhyq4Clygb5Kspge50xo+n8uC/IvXwi+ukRjEpdfX/JZ09yKUCJ2AMMr/QchrsP1Xhg9Q3fEZ4E12XqFd5jX00Qs0K5XZwjBaV8NdDTJW9I4gpcyh0cry7hSBAWHkXEkqbK+lQvR4UFAKejFq6u/wIDAQAB" . "6SkVjBr3vAlplVv5c12Lx/I/rmUNk4ywYfBcmEAdubX6SoNXasT7mC5zDJc6h1SU2pcNKHf3K8yxtxyBmukJjVoWmjWNOOueGXNzzovlAkAhpXArz9iJshdDIWj2KTgFY+wCsuqRoj1zD/bbwqbTpnEyEXewUTa4Z4lI+kKQwyM=" . . . . . . . . . . . . . . . . . . . "Computational prediction of pLDDT (93.74392833444035 unitless, 0-100) for SARS-CoV-2 Spike RBD variant Alpha (N169Y) using AlphaFold 2." . "Alpha pLDDT = 93.74392833444035 — AlphaFold 2" . . . "93.74392833444035"^^ . . "e.a.schultes@lacdr.leidenuniv.nl" . . "2026-06-01T10:30:42Z"^^ . . . . . "Alpha pLDDT = 93.74392833444035 — AlphaFold 2" . . . . . . . "RSA" . "MIGfMA0GCSqGSIb3DQEBAQUAA4GNADCBiQKBgQD3w/IUb755GIzp3ueODYkgELhyq4Clygb5Kspge50xo+n8uC/IvXwi+ukRjEpdfX/JZ09yKUCJ2AMMr/QchrsP1Xhg9Q3fEZ4E12XqFd5jX00Qs0K5XZwjBaV8NdDTJW9I4gpcyh0cry7hSBAWHkXEkqbK+lQvR4UFAKejFq6u/wIDAQAB" . "9lAe+PjzQ3y5hnmDfdTwwdUDHXuEdHLeBIUYu/5uZhWcJsQGWzmrRcd4HTfE6ntMAv4ATXqrouGb4fq9lSbSzcQwuuUpMDHEyg7/t6FOHXdFUDrb/m+KG+pXsfWr/pGp//0VjjBHmyzuBxDn7KLRx8mEBmtUC2WWxHvxIEMkaBI=" . . . . . . . . . . . . . . . . "Real-world detection of SARS-CoV-2 Spike variant Alpha (B.1.1.7) in England during late 2020-2021, as reported in GISAID (accession EPI_ISL_601443)." . "Alpha real-world occurrence — England (late 2020-2021)" . . . "EPI_ISL_601443" . "late 2020-2021" . . . "e.a.schultes@lacdr.leidenuniv.nl" . . "2026-06-01T10:30:42Z"^^ . . . . . "Alpha real-world occurrence — England (late 2020-2021)" . . . . . . . "RSA" . "MIGfMA0GCSqGSIb3DQEBAQUAA4GNADCBiQKBgQD3w/IUb755GIzp3ueODYkgELhyq4Clygb5Kspge50xo+n8uC/IvXwi+ukRjEpdfX/JZ09yKUCJ2AMMr/QchrsP1Xhg9Q3fEZ4E12XqFd5jX00Qs0K5XZwjBaV8NdDTJW9I4gpcyh0cry7hSBAWHkXEkqbK+lQvR4UFAKejFq6u/wIDAQAB" . "R4uukE623yx6biDh5Ft7t9iUwYhfRsOXYOwmEDFhSjSjSAPz8EyNIH/cPxe8R7g0vp5jr4XyV98y7pvTIK2IhyTEX7UDdYlcd026vbexjhit9tO+fTaB0SZUhsK/hspZyq5ecgSn5MbFM6qjQttnxCxu+xd8D4ssHhjJQYLO6Vw=" . . . . . . . . . . . . . . . . "WHO classification of SARS-CoV-2 Spike variant Alpha (B.1.1.7) as a Variant of Concern (VOC) on 2020-12-18." . "Alpha — WHO Variant of Concern (2020-12-18)" . . "2020-12-18" . . . "e.a.schultes@lacdr.leidenuniv.nl" . . "2026-06-01T10:30:42Z"^^ . . . . . "Alpha — WHO Variant of Concern (2020-12-18)" . . . . . . . "RSA" . "MIGfMA0GCSqGSIb3DQEBAQUAA4GNADCBiQKBgQD3w/IUb755GIzp3ueODYkgELhyq4Clygb5Kspge50xo+n8uC/IvXwi+ukRjEpdfX/JZ09yKUCJ2AMMr/QchrsP1Xhg9Q3fEZ4E12XqFd5jX00Qs0K5XZwjBaV8NdDTJW9I4gpcyh0cry7hSBAWHkXEkqbK+lQvR4UFAKejFq6u/wIDAQAB" . "CDmw5hzRl1UqGFIm0xawZrLLGruXEJCvmmZneg62AOaO+Xn/jbNbKnhM/KXJCvdulZWURXWzMRv+y/tsU70akIQXo1pN1IapRWvc3IEWNVZyOIO/XdNJBg1A3zEMyWW7TrTvPZJjFGwzQ+2CBnNod5GVEhmAVTsuJQjxMeTEhGA=" . . . . . . . . . . . . . . . . . . . "Computational prediction of AgMata aggregation propensity score (0.7194974358974362, unitless) for SARS-CoV-2 Spike RBD variant Epsilon (L120R) using the Bio2Byte AgMata predictor. Sequence-derived: one FDO per variant." . "Epsilon AgMata = 0.7194974358974362 — Bio2Byte" . . "0.7194974358974362"^^ . . . "e.a.schultes@lacdr.leidenuniv.nl" . . "2026-06-01T10:30:42Z"^^ . . . . . "Epsilon AgMata = 0.7194974358974362 — Bio2Byte" . . . . . . . "RSA" . "MIGfMA0GCSqGSIb3DQEBAQUAA4GNADCBiQKBgQD3w/IUb755GIzp3ueODYkgELhyq4Clygb5Kspge50xo+n8uC/IvXwi+ukRjEpdfX/JZ09yKUCJ2AMMr/QchrsP1Xhg9Q3fEZ4E12XqFd5jX00Qs0K5XZwjBaV8NdDTJW9I4gpcyh0cry7hSBAWHkXEkqbK+lQvR4UFAKejFq6u/wIDAQAB" . "0KJpUnK9RCvXROhsD4F00yZaYSrwAciqVH80rZGOcHyzYZqtfBuA5xBrX6MKf8NApwGN1W/sAxmTAqAgHhh0UprNCvn/z841VO5yhJ+v99T+L1zu632CZkHRN954Qr7BHHr2DbDdKOkmelQ04g6RRH15SkApI3rjxHwviO0fzK8=" . . . . . . . . . . . . . . . . "Deep mutational scanning measurements (Bloom Lab) for SARS-CoV-2 Spike RBD variant Epsilon (L120R). Six values: bind=8.93862, delta_bind=0.16701, expr=10.25356, delta_expr=0.06768, confidence_bind=0.0729917177063099, confidence_expr=0.0705230077448188. All unitless." . "Epsilon DMS observation — Bloom Lab (bind=8.93862, expr=10.25356)" . . "8.93862"^^ . "0.0729917177063099"^^ . "0.0705230077448188"^^ . "0.16701"^^ . "0.06768"^^ . . "10.25356"^^ . . "e.a.schultes@lacdr.leidenuniv.nl" . . "2026-06-01T10:30:42Z"^^ . . . . . "Epsilon DMS observation — Bloom Lab (bind=8.93862, expr=10.25356)" . . . . . . . "RSA" . "MIGfMA0GCSqGSIb3DQEBAQUAA4GNADCBiQKBgQD3w/IUb755GIzp3ueODYkgELhyq4Clygb5Kspge50xo+n8uC/IvXwi+ukRjEpdfX/JZ09yKUCJ2AMMr/QchrsP1Xhg9Q3fEZ4E12XqFd5jX00Qs0K5XZwjBaV8NdDTJW9I4gpcyh0cry7hSBAWHkXEkqbK+lQvR4UFAKejFq6u/wIDAQAB" . "hT+RXYNOH7bzyALG0vyonLzzdpvrN7bAoY3CtxWoual4ieT1A4yeZjwvLhFQz4klUMfaxYJmH5kskg+qM98C4MX0Fto7aRsLslJgzjVJRbk+u5O1pXcsNhopfYUZcYbsGlaQuvcr+i6KkQs3D5ErPIHEaNe7/SZHVkyDBKpD4ik=" . . . . . . . . . . . . . . . . . . . "Computational prediction of RMSD (12.801648143493145 Angstroms) for SARS-CoV-2 Spike RBD variant Epsilon (L120R) using ESM2." . "Epsilon RMSD = 12.801648143493145 Å — ESM2" . . . "12.801648143493145"^^ . . "e.a.schultes@lacdr.leidenuniv.nl" . . "2026-06-01T10:30:42Z"^^ . . . . . "Epsilon RMSD = 12.801648143493145 Å — ESM2" . . . . . . . "RSA" . "MIGfMA0GCSqGSIb3DQEBAQUAA4GNADCBiQKBgQD3w/IUb755GIzp3ueODYkgELhyq4Clygb5Kspge50xo+n8uC/IvXwi+ukRjEpdfX/JZ09yKUCJ2AMMr/QchrsP1Xhg9Q3fEZ4E12XqFd5jX00Qs0K5XZwjBaV8NdDTJW9I4gpcyh0cry7hSBAWHkXEkqbK+lQvR4UFAKejFq6u/wIDAQAB" . "FQfM+2hMdCzaAZiXZfMF+ihgfTtRTMk8H+1VY9D7sF2npf+XqZC+ygqgHLrA7J0VBm0n9oNsTiuhOd6DZsS9lA0dFfgppbA53Jo+YlpH3ZZUuVfobaLFWm+rA+1JAUfL5haByXRg2fGtQK+0gAnO0GVs+XfKx8rbSdfSpEtuURQ=" . . . . . . . . . . . . . . . . . . . "Computational prediction of RMSD (2.975776098053212 Angstroms) for SARS-CoV-2 Spike RBD variant Epsilon (L120R) using AlphaFold 2." . "Epsilon RMSD = 2.975776098053212 Å — AlphaFold 2" . . . "2.975776098053212"^^ . . "e.a.schultes@lacdr.leidenuniv.nl" . . "2026-06-01T10:30:42Z"^^ . . . . . "Epsilon RMSD = 2.975776098053212 Å — AlphaFold 2" . . . . . . . "RSA" . "MIGfMA0GCSqGSIb3DQEBAQUAA4GNADCBiQKBgQD3w/IUb755GIzp3ueODYkgELhyq4Clygb5Kspge50xo+n8uC/IvXwi+ukRjEpdfX/JZ09yKUCJ2AMMr/QchrsP1Xhg9Q3fEZ4E12XqFd5jX00Qs0K5XZwjBaV8NdDTJW9I4gpcyh0cry7hSBAWHkXEkqbK+lQvR4UFAKejFq6u/wIDAQAB" . "G9TcF5lESduY+IbLZTV60VP/LmhssF4XvWEoe0yBJPzKABD20nnBWsUawReMkomh2M1VWqHgfeMMPffw4LkoK4ts1OMJ5tHH1zmpj1zr1gswBeAvv34NTg3dsazNx2FTOqnpQ2I9ceQfUCTRYFQfHbITTonJ+1k49ym93PIoqW8=" . . . . . . . . . . . . . . . . . . . "Computational prediction of SASA (10181.968717666516 square Angstroms) for SARS-CoV-2 Spike RBD variant Epsilon (L120R) using AlphaFold 2." . "Epsilon SASA = 10181.968717666516 Ų — AlphaFold 2" . . . "10181.968717666516"^^ . . "e.a.schultes@lacdr.leidenuniv.nl" . . "2026-06-01T10:30:42Z"^^ . . . . . "Epsilon SASA = 10181.968717666516 Ų — AlphaFold 2" . . . . . . . "RSA" . "MIGfMA0GCSqGSIb3DQEBAQUAA4GNADCBiQKBgQD3w/IUb755GIzp3ueODYkgELhyq4Clygb5Kspge50xo+n8uC/IvXwi+ukRjEpdfX/JZ09yKUCJ2AMMr/QchrsP1Xhg9Q3fEZ4E12XqFd5jX00Qs0K5XZwjBaV8NdDTJW9I4gpcyh0cry7hSBAWHkXEkqbK+lQvR4UFAKejFq6u/wIDAQAB" . "CYu4RA7tK9oBwlww0SMu8ntjq2tXz1YjcFAANlRwZQJjTpwYKVgMJ7J7T/aZhuWGQItdmj3juUO8Cn/CVVEXm5XFgeZWeSa/3jSFLZirCupCUARpu9oAas0cwvCKG1mm1bNL96CVwuNtD3l70dOAeQ+f/j62gshCxQY2Cv8nRM4=" . . . . . . . . . . . . . . . . . . . "Computational prediction of SASA (17620.862527029858 square Angstroms) for SARS-CoV-2 Spike RBD variant Epsilon (L120R) using ESM2." . "Epsilon SASA = 17620.862527029858 Ų — ESM2" . . . "17620.862527029858"^^ . . "e.a.schultes@lacdr.leidenuniv.nl" . . "2026-06-01T10:30:42Z"^^ . . . . . "Epsilon SASA = 17620.862527029858 Ų — ESM2" . . . . . . . "RSA" . "MIGfMA0GCSqGSIb3DQEBAQUAA4GNADCBiQKBgQD3w/IUb755GIzp3ueODYkgELhyq4Clygb5Kspge50xo+n8uC/IvXwi+ukRjEpdfX/JZ09yKUCJ2AMMr/QchrsP1Xhg9Q3fEZ4E12XqFd5jX00Qs0K5XZwjBaV8NdDTJW9I4gpcyh0cry7hSBAWHkXEkqbK+lQvR4UFAKejFq6u/wIDAQAB" . "pXTJCLP9m2hZW0DCXJvGA2Y7Ew5xS/yszI3tHXECmKAFWwUWAeFFE+dtFZasnhuOp5ySMChLFYrYxoOvsGcLuGpfCtiewEtytrJeyblNikHToQZreqc0V5I9kAvbyWmkEm+4lzi6zJkrl7Xkjdv2KC5qstlLSRA9i7l/1qSgmB4=" . . . . . . . . . . . . . . . . . . . "Computational prediction of pLDDT (23.73609314359643 unitless, 0-100) for SARS-CoV-2 Spike RBD variant Epsilon (L120R) using ESM2." . "Epsilon pLDDT = 23.73609314359643 — ESM2" . . . "23.73609314359643"^^ . . "e.a.schultes@lacdr.leidenuniv.nl" . . "2026-06-01T10:30:42Z"^^ . . . . . "Epsilon pLDDT = 23.73609314359643 — ESM2" . . . . . . . "RSA" . "MIGfMA0GCSqGSIb3DQEBAQUAA4GNADCBiQKBgQD3w/IUb755GIzp3ueODYkgELhyq4Clygb5Kspge50xo+n8uC/IvXwi+ukRjEpdfX/JZ09yKUCJ2AMMr/QchrsP1Xhg9Q3fEZ4E12XqFd5jX00Qs0K5XZwjBaV8NdDTJW9I4gpcyh0cry7hSBAWHkXEkqbK+lQvR4UFAKejFq6u/wIDAQAB" . "mDJRtG64LbddFd+jzB3c1ebBefctETQY+6Qs5ZUmNkxG/8WOxe1vt7rIHGPDreLpIsr4S6X8o6J/pCpJtcNO5dYhB6q6OUZuVLEtFCQKb1NTnN+/ztXLl/qMG/IHYBIT716sG348Ghhsb8wMmq66BCJW3ZVYCCOH0jm4372YGtc=" . . . . . . . . . . . . . . . . . . . "Computational prediction of pLDDT (94.19297808764844 unitless, 0-100) for SARS-CoV-2 Spike RBD variant Epsilon (L120R) using AlphaFold 2." . "Epsilon pLDDT = 94.19297808764844 — AlphaFold 2" . . . "94.19297808764844"^^ . . "e.a.schultes@lacdr.leidenuniv.nl" . . "2026-06-01T10:30:42Z"^^ . . . . . "Epsilon pLDDT = 94.19297808764844 — AlphaFold 2" . . . . . . . "RSA" . "MIGfMA0GCSqGSIb3DQEBAQUAA4GNADCBiQKBgQD3w/IUb755GIzp3ueODYkgELhyq4Clygb5Kspge50xo+n8uC/IvXwi+ukRjEpdfX/JZ09yKUCJ2AMMr/QchrsP1Xhg9Q3fEZ4E12XqFd5jX00Qs0K5XZwjBaV8NdDTJW9I4gpcyh0cry7hSBAWHkXEkqbK+lQvR4UFAKejFq6u/wIDAQAB" . "ZI1lDwQLX7eH4AmILZuhkEqdxoMS4y1a941u4lqcHp3+WcvOcdBjlyDYvhZbLyeF/PbZQAbMusZ80haHIfeFh/YXyJAOW32VfbGUR7XkSaprlE/AZeENqLrQh9W7PcXjjPEWAkGgAKv2dqCKK6kjAcAcCxeNIKL2wYZS/gvYjy4=" . . . . . . . . . . . . . . . . "Real-world detection of SARS-CoV-2 Spike variant Epsilon (B.1.427 + B.1.429) in the United States on 2021-01-13, as reported in GISAID (accession EPI_ISL_2295356)." . "Epsilon real-world occurrence — United States (2021-01-13)" . . . "EPI_ISL_2295356" . "2021-01-13" . . . "e.a.schultes@lacdr.leidenuniv.nl" . . "2026-06-01T10:30:42Z"^^ . . . . . "Epsilon real-world occurrence — United States (2021-01-13)" . . . . . . . "RSA" . "MIGfMA0GCSqGSIb3DQEBAQUAA4GNADCBiQKBgQD3w/IUb755GIzp3ueODYkgELhyq4Clygb5Kspge50xo+n8uC/IvXwi+ukRjEpdfX/JZ09yKUCJ2AMMr/QchrsP1Xhg9Q3fEZ4E12XqFd5jX00Qs0K5XZwjBaV8NdDTJW9I4gpcyh0cry7hSBAWHkXEkqbK+lQvR4UFAKejFq6u/wIDAQAB" . "rhj9T841WLhWMSSboy1oFI9rCzBpb8dXw899mCeh/IecYCi8U1sWNRw062//RfiLOSY+QqFg2dzX3ZZ2T0GydI0TDp11NMxO0GFC7N9lLdtJoyNIUEkyrkvxrgYXoCCltnpX7TofFv5eVqGGOx2A9BFlIxkd9Df3GnftecFSLGg=" . . . . . . . . . . . . . . . . "WHO classification of SARS-CoV-2 Spike variant Epsilon (B.1.427 + B.1.429) as a Variant of Interest (VOI) on 2021-03-05." . "Epsilon — WHO Variant of Interest (2021-03-05)" . . "2021-03-05" . . . "e.a.schultes@lacdr.leidenuniv.nl" . . "2026-06-01T10:30:42Z"^^ . . . . . "Epsilon — WHO Variant of Interest (2021-03-05)" . . . . . . . "RSA" . "MIGfMA0GCSqGSIb3DQEBAQUAA4GNADCBiQKBgQD3w/IUb755GIzp3ueODYkgELhyq4Clygb5Kspge50xo+n8uC/IvXwi+ukRjEpdfX/JZ09yKUCJ2AMMr/QchrsP1Xhg9Q3fEZ4E12XqFd5jX00Qs0K5XZwjBaV8NdDTJW9I4gpcyh0cry7hSBAWHkXEkqbK+lQvR4UFAKejFq6u/wIDAQAB" . "SunLtjIYF6onmnlMkpMetv5EUSl8DnsWuBO3d1RH3UJ6kENz+96cyq/jPFEFQdT2n3kLYzjX02wwHhWPbXoSA6CUpmcIIQVqWU1+gOYM8bYhAh87Kj8oFHXKLh3WH0NT/jsmL5yadZGSFIYtZF/5NMCb/E+6w6zwZdDTEWKTCcw=" . . . . . . . . . . . . . . . . . . . "Computational prediction of AgMata aggregation propensity score (0.680579487179487, unitless) for SARS-CoV-2 Spike RBD variant Eta (E152K) using the Bio2Byte AgMata predictor. Sequence-derived: one FDO per variant." . "Eta AgMata = 0.680579487179487 — Bio2Byte" . . "0.680579487179487"^^ . . . "e.a.schultes@lacdr.leidenuniv.nl" . . "2026-06-01T10:30:42Z"^^ . . . . . "Eta AgMata = 0.680579487179487 — Bio2Byte" . . . . . . . "RSA" . "MIGfMA0GCSqGSIb3DQEBAQUAA4GNADCBiQKBgQD3w/IUb755GIzp3ueODYkgELhyq4Clygb5Kspge50xo+n8uC/IvXwi+ukRjEpdfX/JZ09yKUCJ2AMMr/QchrsP1Xhg9Q3fEZ4E12XqFd5jX00Qs0K5XZwjBaV8NdDTJW9I4gpcyh0cry7hSBAWHkXEkqbK+lQvR4UFAKejFq6u/wIDAQAB" . "KVfasQjO0Sp+f3tJXFWxaq8hb1EEvF5SWEcbWMM9ofF008OMK6Op6TLGpL+/aTQBEti0DI+606bSteVNVEgMTcJuXL/tdLCvS0Gqt1buOJ6orFXjRokWJXIjp5X77f/WAAAeyASpu4Z5R0MJrzm2dko1whKS9eC+9uxDFP12vpQ=" . . . . . . . . . . . . . . . . "Deep mutational scanning measurements (Bloom Lab) for SARS-CoV-2 Spike RBD variant Eta (E152K). Six values: bind=9.01256, delta_bind=0.24095, expr=10.21898, delta_expr=0.03311, confidence_bind=0.0722604927671021, confidence_expr=0.0697838486111459. All unitless." . "Eta DMS observation — Bloom Lab (bind=9.01256, expr=10.21898)" . . "9.01256"^^ . "0.0722604927671021"^^ . "0.0697838486111459"^^ . "0.24095"^^ . "0.03311"^^ . . "10.21898"^^ . . "e.a.schultes@lacdr.leidenuniv.nl" . . "2026-06-01T10:30:42Z"^^ . . . . . "Eta DMS observation — Bloom Lab (bind=9.01256, expr=10.21898)" . . . . . . . "RSA" . "MIGfMA0GCSqGSIb3DQEBAQUAA4GNADCBiQKBgQD3w/IUb755GIzp3ueODYkgELhyq4Clygb5Kspge50xo+n8uC/IvXwi+ukRjEpdfX/JZ09yKUCJ2AMMr/QchrsP1Xhg9Q3fEZ4E12XqFd5jX00Qs0K5XZwjBaV8NdDTJW9I4gpcyh0cry7hSBAWHkXEkqbK+lQvR4UFAKejFq6u/wIDAQAB" . "cYh1H6tYKJWYAR71YRBPBNrVyCwtEhfxsSIb+LLuUfjDhiuqEiGdNMeFSjCMlnnQOcWz1iieAN43UsK6oPJwKkdyc9C8xXrHGwd9+ZzegR74ihcQLDPkavQKTrnUmSuoqgLEFd44tK/7R/PL1acgd+xY+Xgq+wWUfLpat2EJdXc=" . . . . . . . . . . . . . . . . . . . "Computational prediction of RMSD (2.476768477258109 Angstroms) for SARS-CoV-2 Spike RBD variant Eta (E152K) using ESM2." . "Eta RMSD = 2.476768477258109 Å — ESM2" . . . "2.476768477258109"^^ . . "e.a.schultes@lacdr.leidenuniv.nl" . . "2026-06-01T10:30:42Z"^^ . . . . . "Eta RMSD = 2.476768477258109 Å — ESM2" . . . . . . . "RSA" . "MIGfMA0GCSqGSIb3DQEBAQUAA4GNADCBiQKBgQD3w/IUb755GIzp3ueODYkgELhyq4Clygb5Kspge50xo+n8uC/IvXwi+ukRjEpdfX/JZ09yKUCJ2AMMr/QchrsP1Xhg9Q3fEZ4E12XqFd5jX00Qs0K5XZwjBaV8NdDTJW9I4gpcyh0cry7hSBAWHkXEkqbK+lQvR4UFAKejFq6u/wIDAQAB" . "bW4iFCo7tmN7jA+O1TEKr5zAZ0Zuf1teTQ219uMksKhPm24p4mYhklVVdZMCWyuCTt1pysF7JcGoPI1mZbN779Dq2XbJwtt8z4wsYWcOfT/eiXm6D9p/nghcK+NV4ODN1iSCvI0Zlc8owkiMhDAstPs7NE293K2Pdj9/SO9o4oM=" . . . . . . . . . . . . . . . . . . . "Computational prediction of RMSD (2.7195180252543003 Angstroms) for SARS-CoV-2 Spike RBD variant Eta (E152K) using AlphaFold 2." . "Eta RMSD = 2.7195180252543003 Å — AlphaFold 2" . . . "2.7195180252543003"^^ . . "e.a.schultes@lacdr.leidenuniv.nl" . . "2026-06-01T10:30:42Z"^^ . . . . . "Eta RMSD = 2.7195180252543003 Å — AlphaFold 2" . . . . . . . "RSA" . "MIGfMA0GCSqGSIb3DQEBAQUAA4GNADCBiQKBgQD3w/IUb755GIzp3ueODYkgELhyq4Clygb5Kspge50xo+n8uC/IvXwi+ukRjEpdfX/JZ09yKUCJ2AMMr/QchrsP1Xhg9Q3fEZ4E12XqFd5jX00Qs0K5XZwjBaV8NdDTJW9I4gpcyh0cry7hSBAWHkXEkqbK+lQvR4UFAKejFq6u/wIDAQAB" . "UDh4TSKj9IVd3I9VOuRsqb1PC3t2magFJDcHX99WCtD1aHFEes0W5Iel6wX/OGlLZnqxTP3VTCrfzGOOXSgMzRQoXcMb7XlnwQGTsOoxx+qn+kkjcUBYN8en+fLsluA+Cv26Bx36ltR9u43qUaB9iNB5/2iUn5qy7CMhvC+xXf0=" . . . . . . . . . . . . . . . . . . . "Computational prediction of SASA (10226.641288430395 square Angstroms) for SARS-CoV-2 Spike RBD variant Eta (E152K) using AlphaFold 2." . "Eta SASA = 10226.641288430395 Ų — AlphaFold 2" . . . "10226.641288430395"^^ . . "e.a.schultes@lacdr.leidenuniv.nl" . . "2026-06-01T10:30:42Z"^^ . . . . . "Eta SASA = 10226.641288430395 Ų — AlphaFold 2" . . . . . . . "RSA" . "MIGfMA0GCSqGSIb3DQEBAQUAA4GNADCBiQKBgQD3w/IUb755GIzp3ueODYkgELhyq4Clygb5Kspge50xo+n8uC/IvXwi+ukRjEpdfX/JZ09yKUCJ2AMMr/QchrsP1Xhg9Q3fEZ4E12XqFd5jX00Qs0K5XZwjBaV8NdDTJW9I4gpcyh0cry7hSBAWHkXEkqbK+lQvR4UFAKejFq6u/wIDAQAB" . "vdB9tBWqYkWudeZdMwbBInHD1YP6hnIwnxctmGTHGos4qOD3gmymriQMgj4cQS2MUp+JmCc+v4em5YzH6PHePdq4KdJvohtYsMFz+ogCxnfaIH1wNRr6yy4xMQOTGnobuUsGTWv+zUJeNYftPtRwZQ+4Rc7PsJJ/DUwx7vOOXzk=" . . . . . . . . . . . . . . . . . . . "Computational prediction of SASA (18026.596842240684 square Angstroms) for SARS-CoV-2 Spike RBD variant Eta (E152K) using ESM2." . "Eta SASA = 18026.596842240684 Ų — ESM2" . . . "18026.596842240684"^^ . . "e.a.schultes@lacdr.leidenuniv.nl" . . "2026-06-01T10:30:42Z"^^ . . . . . "Eta SASA = 18026.596842240684 Ų — ESM2" . . . . . . . "RSA" . "MIGfMA0GCSqGSIb3DQEBAQUAA4GNADCBiQKBgQD3w/IUb755GIzp3ueODYkgELhyq4Clygb5Kspge50xo+n8uC/IvXwi+ukRjEpdfX/JZ09yKUCJ2AMMr/QchrsP1Xhg9Q3fEZ4E12XqFd5jX00Qs0K5XZwjBaV8NdDTJW9I4gpcyh0cry7hSBAWHkXEkqbK+lQvR4UFAKejFq6u/wIDAQAB" . "AKIbl4AU9xTP01Ro18qLZZ3XZSKAZ9dA6pqnIhwrYKhmagEKf5g3eQ+RWhP2k5Cs5HTQ0q46t3Bdnca6AmsE6Wx5monwTDBPos3xRlIZySuJrqD1BgctmI12QJGzFIIr3zbNlwPmrvxw3fANsH4c+JKUwvFhAOdgSJXWefrIPOc=" . . . . . . . . . . . . . . . . . . . "Computational prediction of pLDDT (23.15035644847704 unitless, 0-100) for SARS-CoV-2 Spike RBD variant Eta (E152K) using ESM2." . "Eta pLDDT = 23.15035644847704 — ESM2" . . . "23.15035644847704"^^ . . "e.a.schultes@lacdr.leidenuniv.nl" . . "2026-06-01T10:30:42Z"^^ . . . . . "Eta pLDDT = 23.15035644847704 — ESM2" . . . . . . . "RSA" . "MIGfMA0GCSqGSIb3DQEBAQUAA4GNADCBiQKBgQD3w/IUb755GIzp3ueODYkgELhyq4Clygb5Kspge50xo+n8uC/IvXwi+ukRjEpdfX/JZ09yKUCJ2AMMr/QchrsP1Xhg9Q3fEZ4E12XqFd5jX00Qs0K5XZwjBaV8NdDTJW9I4gpcyh0cry7hSBAWHkXEkqbK+lQvR4UFAKejFq6u/wIDAQAB" . "QP+ySDMSFasoP6BYvmI8udxqfbiRNP8sMVUCgkC92h8OLy17F/IfINd9qGPjB9/kFnFUwlJp3ny9g2yVNa0PmaFX1047rUF+hHW8cNgHKFgOIVeq28b8rpkfSAoGNJCoZ1NXT0umgHbwbWdgcyEmcwMsoF71bveUH0ILBXm8i3c=" . . . . . . . . . . . . . . . . . . . "Computational prediction of pLDDT (94.05421698739244 unitless, 0-100) for SARS-CoV-2 Spike RBD variant Eta (E152K) using AlphaFold 2." . "Eta pLDDT = 94.05421698739244 — AlphaFold 2" . . . "94.05421698739244"^^ . . "e.a.schultes@lacdr.leidenuniv.nl" . . "2026-06-01T10:30:42Z"^^ . . . . . "Eta pLDDT = 94.05421698739244 — AlphaFold 2" . . . . . . . "RSA" . "MIGfMA0GCSqGSIb3DQEBAQUAA4GNADCBiQKBgQD3w/IUb755GIzp3ueODYkgELhyq4Clygb5Kspge50xo+n8uC/IvXwi+ukRjEpdfX/JZ09yKUCJ2AMMr/QchrsP1Xhg9Q3fEZ4E12XqFd5jX00Qs0K5XZwjBaV8NdDTJW9I4gpcyh0cry7hSBAWHkXEkqbK+lQvR4UFAKejFq6u/wIDAQAB" . "jXDO+L8uNQq1ENF05EZDsdIklvrMHOUqcAtwr6sf0JAnoFS5Aop/Edhe9O11Si+M/9G539VVTLjUp0fN7vaXGK4k0MNZ5LFTRxVJ5DK377z6btE7PmN5EE7WsoR4BFwqlyn4PByaHywbbZVVyV58at142XuOmknTTtf6LFuW6Kc=" . . . . . . . . . . . . . . . . "Real-world detection of SARS-CoV-2 Spike variant Eta (B.1.525) in Nigeria on 2020-12-15, as reported in GISAID (accession EPI_ISL_941290)." . "Eta real-world occurrence — Nigeria (2020-12-15)" . . . "EPI_ISL_941290" . "2020-12-15" . . . "e.a.schultes@lacdr.leidenuniv.nl" . . "2026-06-01T10:30:42Z"^^ . . . . . "Eta real-world occurrence — Nigeria (2020-12-15)" . . . . . . . "RSA" . "MIGfMA0GCSqGSIb3DQEBAQUAA4GNADCBiQKBgQD3w/IUb755GIzp3ueODYkgELhyq4Clygb5Kspge50xo+n8uC/IvXwi+ukRjEpdfX/JZ09yKUCJ2AMMr/QchrsP1Xhg9Q3fEZ4E12XqFd5jX00Qs0K5XZwjBaV8NdDTJW9I4gpcyh0cry7hSBAWHkXEkqbK+lQvR4UFAKejFq6u/wIDAQAB" . "kgucyiJqgUWaZAEHptpGpGmi89HBFv4pSET4phJtg8fBRiNKKCy2bRJQoyNn9JlizSBkhnk5HxEyVEX6PtRGbUtmTAm/JuQ7HPHm7lbNWUBL73Rb4vxMD536GqH1trPeWxOPQUp8m0v82Nx8PQ+aVEAXIF6jmOBaluLejEgw6IE=" . . . . . . . . . . . . . . . . "WHO classification of SARS-CoV-2 Spike variant Eta (B.1.525) as a Variant of Interest (VOI) on 2021-03-05." . "Eta — WHO Variant of Interest (2021-03-05)" . . "2021-03-05" . . . "e.a.schultes@lacdr.leidenuniv.nl" . . "2026-06-01T10:30:42Z"^^ . . . . . "Eta — WHO Variant of Interest (2021-03-05)" . . . . . . . "RSA" . "MIGfMA0GCSqGSIb3DQEBAQUAA4GNADCBiQKBgQD3w/IUb755GIzp3ueODYkgELhyq4Clygb5Kspge50xo+n8uC/IvXwi+ukRjEpdfX/JZ09yKUCJ2AMMr/QchrsP1Xhg9Q3fEZ4E12XqFd5jX00Qs0K5XZwjBaV8NdDTJW9I4gpcyh0cry7hSBAWHkXEkqbK+lQvR4UFAKejFq6u/wIDAQAB" . "A++fPhZ11O605ADuqC+kus5SpPvzwy9pTnvz+KI1zyc0z+BoaGMw2YNWY2CjOexOuQih0xzY7BVgozwu+QCgOnjPik9Q8Q1CfGYWSHE2c/wg5OcgShqMcf4nVkT6rVgNrUvJYpF2EyxNe+t4+OZpZOiBgY+uZE1pvrFrzhegqIQ=" . . . . . . . . . . . . . . . . . . "AlphaFold 2 (DeepMind) protein structure prediction system." . "AlphaFold 2 — DeepMind structure predictor" . . "e.a.schultes@lacdr.leidenuniv.nl" . . "2026-06-01T10:23:12Z"^^ . . . . . "AlphaFold 2 — DeepMind structure predictor" . . . . . . . "RSA" . "MIGfMA0GCSqGSIb3DQEBAQUAA4GNADCBiQKBgQD3w/IUb755GIzp3ueODYkgELhyq4Clygb5Kspge50xo+n8uC/IvXwi+ukRjEpdfX/JZ09yKUCJ2AMMr/QchrsP1Xhg9Q3fEZ4E12XqFd5jX00Qs0K5XZwjBaV8NdDTJW9I4gpcyh0cry7hSBAWHkXEkqbK+lQvR4UFAKejFq6u/wIDAQAB" . "hZUFAcB6U+RmXOXZsYKoptWzv/18cHX8MK03zam7inlOoykAGxo0PuquJt5JWx8Z9zx6noRn6IggHF86Gg1WBA66UfUiECjXU3SI1VtA/3dMQxec2mSJxJ8LmdauVJsGYuS1wuD3Xr8E1ucJEXVmm3BrylfQC+0oN4FBBYcK6v8=" . . . . . . . . . . . . . . . . . . "AgMata aggregation propensity predictor, Bio2Byte toolkit." . "Bio2Byte AgMata — aggregation propensity predictor" . . "e.a.schultes@lacdr.leidenuniv.nl" . . "2026-06-01T10:23:12Z"^^ . . . . . "Bio2Byte AgMata — aggregation propensity predictor" . . . . . . . "RSA" . "MIGfMA0GCSqGSIb3DQEBAQUAA4GNADCBiQKBgQD3w/IUb755GIzp3ueODYkgELhyq4Clygb5Kspge50xo+n8uC/IvXwi+ukRjEpdfX/JZ09yKUCJ2AMMr/QchrsP1Xhg9Q3fEZ4E12XqFd5jX00Qs0K5XZwjBaV8NdDTJW9I4gpcyh0cry7hSBAWHkXEkqbK+lQvR4UFAKejFq6u/wIDAQAB" . "E4YI3388bPMNWkBco4p8c/SfTgQVWQmWTCiXTMD5drzUNtQomPLVVlPpyIc8hRTDotaVdBZ/5YDpRDs3EgSB+gdj3tjHm0z0D2EWkFmc/1cde6VmIZBkNNc0dnUO+/TN/2rsZzSiQEXl5bfUcydSEZZSdDdLwocU81hO21OAJdU=" . . . . . . . . . . . . . . . . . . "Deep mutational scanning of SARS-CoV-2 RBD binding and expression, Bloom Lab." . "Deep mutational scanning — Bloom Lab SARS-CoV-2 RBD" . . "e.a.schultes@lacdr.leidenuniv.nl" . . "2026-06-01T10:23:12Z"^^ . . . . . "Deep mutational scanning — Bloom Lab SARS-CoV-2 RBD" . . . . . . . "RSA" . "MIGfMA0GCSqGSIb3DQEBAQUAA4GNADCBiQKBgQD3w/IUb755GIzp3ueODYkgELhyq4Clygb5Kspge50xo+n8uC/IvXwi+ukRjEpdfX/JZ09yKUCJ2AMMr/QchrsP1Xhg9Q3fEZ4E12XqFd5jX00Qs0K5XZwjBaV8NdDTJW9I4gpcyh0cry7hSBAWHkXEkqbK+lQvR4UFAKejFq6u/wIDAQAB" . "RtY0JOMP8Afg/qNUhIRZIa08Fj9yK1uVY8tZyoKK8oyxpt2Va2jXSEo9PXZ9x9g6xZJMDpd7JVmcH+1DluQrktwkk9v4zI7rmvVtHSCN1YHW6XnuxhhOdzNbe0JeoTHwAk07HHLL8nrHcazpRF8Fe1Y6+eMnX3fA7Oac7/Rdbfg=" . . . . . . . . . . . . . . . . . . "ESM2 protein language model (Meta AI) for structure and property prediction from sequence." . "ESM2 — Meta AI protein language model" . . "e.a.schultes@lacdr.leidenuniv.nl" . . "2026-06-01T10:23:12Z"^^ . . . . . "ESM2 — Meta AI protein language model" . . . . . . . "RSA" . "MIGfMA0GCSqGSIb3DQEBAQUAA4GNADCBiQKBgQD3w/IUb755GIzp3ueODYkgELhyq4Clygb5Kspge50xo+n8uC/IvXwi+ukRjEpdfX/JZ09yKUCJ2AMMr/QchrsP1Xhg9Q3fEZ4E12XqFd5jX00Qs0K5XZwjBaV8NdDTJW9I4gpcyh0cry7hSBAWHkXEkqbK+lQvR4UFAKejFq6u/wIDAQAB" . "PhsD/kY3fzq+/vztvteflSYeliB45ngMCFuRoOWb/cQehzhwxScAzqe8LvP0DPWdE9R4w3T05xRscwtfzl92DEFqLiAwEW20oqOmY8TkiV/spr26mKC0/eO9iRVjth0uWj8jIbLth92bzctkJOwz3V2ZL9k/p0hPUtUiqKTYrhU=" . . . . . . . . . . . . . . . . . . . "GISAID SARS-CoV-2 genomic surveillance platform." . "GISAID — Global Initiative on Sharing All Influenza Data" . . "e.a.schultes@lacdr.leidenuniv.nl" . . "2026-06-01T10:23:12Z"^^ . . . . . "GISAID — Global Initiative on Sharing All Influenza Data" . . . . . . . "RSA" . "MIGfMA0GCSqGSIb3DQEBAQUAA4GNADCBiQKBgQD3w/IUb755GIzp3ueODYkgELhyq4Clygb5Kspge50xo+n8uC/IvXwi+ukRjEpdfX/JZ09yKUCJ2AMMr/QchrsP1Xhg9Q3fEZ4E12XqFd5jX00Qs0K5XZwjBaV8NdDTJW9I4gpcyh0cry7hSBAWHkXEkqbK+lQvR4UFAKejFq6u/wIDAQAB" . "JjLyVy/BTExDh6mkzkwJM3PclfrNxz7JC+Cwq4eNAg/L/kfhGXBDClnMr2GRkcU/o16NisB7EVi2UsKOHkF8ydyUEKgaGZ08jlBbFxUTdyyHbekl7hlsnZQ5QpN7i88dYaKlFH03ko472bJIx+02rNhM6jNGYICHrqDTeGTsN4U=" . . . . . . . . . . . . . . . . . . "SARS-CoV-2 Spike RBD variant Alpha, carrying the N169Y substitution (corresponding to N501Y in the full Spike numbering). Pango lineage B.1.1.7. Designated a Variant of Concern (VOC) by the WHO. RBD anchor FDO for the MAC FAIR Digital Twin observation cluster — all Type 2-8 observation FDOs of this variant link back here via mac:isObservationOf." . "Spike RBD Variant Alpha (N169Y)" . . "EPI_ISL_601443" . "N501Y" . "N169Y" . "B.1.1.7" . . "TNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTYGVGYQPYRVVVLSFELLHAPATVCGP" . "Alpha" . "e.a.schultes@lacdr.leidenuniv.nl" . . "2026-06-01T10:23:12Z"^^ . . . . . "Spike RBD Variant Alpha (N169Y)" . . . . . . . "RSA" . "MIGfMA0GCSqGSIb3DQEBAQUAA4GNADCBiQKBgQD3w/IUb755GIzp3ueODYkgELhyq4Clygb5Kspge50xo+n8uC/IvXwi+ukRjEpdfX/JZ09yKUCJ2AMMr/QchrsP1Xhg9Q3fEZ4E12XqFd5jX00Qs0K5XZwjBaV8NdDTJW9I4gpcyh0cry7hSBAWHkXEkqbK+lQvR4UFAKejFq6u/wIDAQAB" . "J3GenG6t5SPEIm/c+e34CBXZSf8EUjDKESzsGeV1FENGpJAuuCBqW6hV/2unMu1ax/DsgvvELK0yeAo9maf9CX9kih49GkwhtDhnu2JThci8Xqy+SqwjjRDcw/hLmmRygLpNG4keNQn9QkjJcPi0UDznD0pyL/7ac0YL4+FDEOI=" . . . . . . . . . . . . . . . . . . "SARS-CoV-2 Spike RBD variant Epsilon, carrying the L120R substitution (corresponding to L452R in the full Spike numbering — Epsilon's canonical defining mutation). Pango lineage B.1.427 + B.1.429 (composite). RBD anchor FDO for the MAC FAIR Digital Twin observation cluster — all Type 2-8 observation FDOs of this variant link back here via mac:isObservationOf." . "Spike RBD Variant Epsilon (L120R)" . . "EPI_ISL_2295356" . "L452R" . "L120R" . "B.1.427 + B.1.429" . . "TNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYRYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGP" . "Epsilon" . "e.a.schultes@lacdr.leidenuniv.nl" . . "2026-06-01T10:23:12Z"^^ . . . . . "Spike RBD Variant Epsilon (L120R)" . . . . . . . "RSA" . "MIGfMA0GCSqGSIb3DQEBAQUAA4GNADCBiQKBgQD3w/IUb755GIzp3ueODYkgELhyq4Clygb5Kspge50xo+n8uC/IvXwi+ukRjEpdfX/JZ09yKUCJ2AMMr/QchrsP1Xhg9Q3fEZ4E12XqFd5jX00Qs0K5XZwjBaV8NdDTJW9I4gpcyh0cry7hSBAWHkXEkqbK+lQvR4UFAKejFq6u/wIDAQAB" . "1ONNd8b5hIJt65f/N7KgKoWVr3kWo8N/xd+1Z/qO6lJD3nd7yRC8angnm2qpyvucYGFRImoRyHZLiVPHgiN5arXNYPOpfppBlc0TzjpA2eOn/lM9CWyB3PDmRNTFo63DNZSIwK91UjpvxJrYHtchzuBETJnMzCHM4t/URm4nYSI=" . . . . . . . . . . . . . . . . . . "SARS-CoV-2 Spike RBD variant Eta, carrying the E152K substitution (corresponding to E484K in the full Spike numbering). Pango lineage B.1.525. Designated a Variant of Interest (VOI) by the WHO. RBD anchor FDO for the MAC FAIR Digital Twin observation cluster — all Type 2-8 observation FDOs of this variant link back here via mac:isObservationOf." . "Spike RBD Variant Eta (E152K)" . . "EPI_ISL_941290" . "E484K" . "E152K" . "B.1.525" . . "TNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVKGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGP" . "Eta" . "e.a.schultes@lacdr.leidenuniv.nl" . . "2026-06-01T10:23:12Z"^^ . . . . . "Spike RBD Variant Eta (E152K)" . . . . . . . "RSA" . "MIGfMA0GCSqGSIb3DQEBAQUAA4GNADCBiQKBgQD3w/IUb755GIzp3ueODYkgELhyq4Clygb5Kspge50xo+n8uC/IvXwi+ukRjEpdfX/JZ09yKUCJ2AMMr/QchrsP1Xhg9Q3fEZ4E12XqFd5jX00Qs0K5XZwjBaV8NdDTJW9I4gpcyh0cry7hSBAWHkXEkqbK+lQvR4UFAKejFq6u/wIDAQAB" . "JKNjtnKJrC6QAbrj2HvDZt56RjuCowVJDY2J1LINrseFZZ8a+gJNKUqONdozkCngKWSJOfpmFQtvj6XaJukeAXmKt2mEPAGB7+nmhYNo5a2b+qDkL7I3eIuEVUc+QJ32DgXgGJop7Zni5kk+NbSoW+f7IShSP2kf0aKA+JFABy8=" . . . . . . . "2025-07-01" . . . . . . . "v1.0.0" . . . . . . . . . . "SARS-COV-2 Spike protein RBD variant structural features calculated with AlphaFold2" . "AlphaFold2 Dataset STAYAHEAD" . . . "e.a.schultes@lacdr.leidenuniv.nl" . . "CC BY 4.0 | Attribution 4.0 International - Using this licence you are free to share and adapt the resource but you must ..." . "Erik Schultes" . "STAYAHEAD" . "2026-05-31T22:40:03Z"^^ . . . . . . "Re-mint of AlphaFold Dataset v2 in /-form convention. Supersedes v1 directly. The intermediate #-form version (http://purl.org/np/RAMOJpRJcZVEFqxJfdvLIF5Qjfi1db9FeROfosXL7XE58) was retracted due to a nanopub-py 2.0.1 signer separator defect (sub: prefix canonicalized with # instead of /, breaking referent resolution against the MAC catalogue / convention)." . . . . . . . . . . "RSA" . "MIGfMA0GCSqGSIb3DQEBAQUAA4GNADCBiQKBgQD3w/IUb755GIzp3ueODYkgELhyq4Clygb5Kspge50xo+n8uC/IvXwi+ukRjEpdfX/JZ09yKUCJ2AMMr/QchrsP1Xhg9Q3fEZ4E12XqFd5jX00Qs0K5XZwjBaV8NdDTJW9I4gpcyh0cry7hSBAWHkXEkqbK+lQvR4UFAKejFq6u/wIDAQAB" . "sfgjUkQj1ss4G+fqidrIwbMc7VqFnYzAOh9OuN/1qouspomMPWOzWD0hHlCY49IRqVfqvlLq/gWeL7RXH0U8Qy/6Tix6yJAxEUrYTe8EYujRc19PMdWCU1OdurigdWyDWi03cLLg+T/Mu2wmJtPHAQJmhAEcF6cNoQSMZsT16FA=" . . . . . . . "2025-07-01" . . . . . . . "v1.0.0" . . . . . . . . . . "SARS-COV-2 Spike protein RBD variant structural features calculated with ESM" . "ESM Dataset STAYAHEAD" . . . "e.a.schultes@lacdr.leidenuniv.nl" . . "CC BY 4.0 | Attribution 4.0 International - Using this licence you are free to share and adapt the resource but you must ..." . "Erik Schultes" . "STAYAHEAD" . "2026-05-31T22:40:03Z"^^ . . . . . . "Re-mint of ESM Dataset v2 in /-form convention. Supersedes v1 directly. The intermediate #-form version (http://purl.org/np/RAy-pG5fwX53YEX_Wfmw-xUmpI9RsPTaw8l8Fn_j_CJIw) was retracted due to a nanopub-py 2.0.1 signer separator defect (sub: prefix canonicalized with # instead of /, breaking referent resolution against the MAC catalogue / convention)." . . . . . . . . . . . "RSA" . "MIGfMA0GCSqGSIb3DQEBAQUAA4GNADCBiQKBgQD3w/IUb755GIzp3ueODYkgELhyq4Clygb5Kspge50xo+n8uC/IvXwi+ukRjEpdfX/JZ09yKUCJ2AMMr/QchrsP1Xhg9Q3fEZ4E12XqFd5jX00Qs0K5XZwjBaV8NdDTJW9I4gpcyh0cry7hSBAWHkXEkqbK+lQvR4UFAKejFq6u/wIDAQAB" . "wCSYc+gH6svn2Qd9B02p7AZsVMjV0UlNZzlZIECbgHSOy29bhVwuiOc+wWUqv/a66OLhNe44dqgEyoWf0Y79HRDpdM14YXv1B4hfIHNegaquv83jIW/ItVc07H1bZydNskMZkZr30kNdb0B2aEMFJmC2PzGTVZOdGO4iNed7RxQ=" . . . . . . . "2023-03-01" . . . . . . . . . . . . . . "This project will develop rapid SARS-CoV-2 detection and variant characterization using mass spectrometry, FAIR Digital Twins of variants, and coupled to AI predictions of variants of high risk." . "STAYAHEAD" . . . . . . "LSHM22038-H026" . . . . "e.a.schultes@lacdr.leidenuniv.nl" . "2026-03-31" . "2023-03-01" . . "CC BY 4.0 | Attribution 4.0 International - Using this licence you are free to share and adapt the resource but you must ..." . "Erik Schultes" . "2026-05-31T22:06:24Z"^^ . . . . . . "Re-mint of Project v2 in /-form convention. Supersedes v1 directly. The intermediate #-form version (http://purl.org/np/RAtVDD78c1d8ANCXc6B0Gz7EjRweOPfR1dTsMONS4MZrE) was retracted due to a nanopub-py 2.0.1 signer separator defect (sub: prefix canonicalized with # instead of /, breaking referent resolution against the MAC catalogue / convention)." . . . . . . . . . . "RSA" . "MIGfMA0GCSqGSIb3DQEBAQUAA4GNADCBiQKBgQD3w/IUb755GIzp3ueODYkgELhyq4Clygb5Kspge50xo+n8uC/IvXwi+ukRjEpdfX/JZ09yKUCJ2AMMr/QchrsP1Xhg9Q3fEZ4E12XqFd5jX00Qs0K5XZwjBaV8NdDTJW9I4gpcyh0cry7hSBAWHkXEkqbK+lQvR4UFAKejFq6u/wIDAQAB" . "x5BGNfGofAJ8PZi4oC2jW34ICR3iZ2O9ZVyiX9sSnSmgNACbpaLkujHUTbK8zdozBXC0xjgJlex1drpJ26bUbFRXKTx2N3EY+yefTelgGgnhnVR1T+gM/W2NTZcgSeS5xCmEpnRTEWlp+YCZBch7vpFxEIKDvYIQATLZVzJa1Qc=" . . . . . . . "" . "Chemistry" . . "Małgorzata Wolniewicz" . . . . . . . . "3749"^^ . "https://api.rohub.org/api/ros/0c470650-84d9-40e1-bc80-4591a27f6c4d/crate/download/" . . "2022-01-12 16:34:39.917729+00:00" . "2026-05-19 11:46:00.057896+00:00" . "2022-01-12 16:34:39.917729+00:00" . "Aromatic compounds are those chemical compounds (most commonly organic) that contain one or more rings with pi electrons delocalized all the way around them. In contrast to compounds that exhibit aromaticity, aliphatic compounds lack this delocalization. The term \"aromatic\" was assigned before the physical mechanism determining aromaticity was discovered, and referred simply to the fact that many such compounds have a sweet or pleasant odour; however, not all aromatic compounds have a sweet odour, and not all compounds with a sweet odour are aromatic compounds. Aromatic hydrocarbons, or arenes, are aromatic organic compounds containing solely carbon and hydrogen atoms. The configuration of six carbon atoms in aromatic compounds is called a \"benzene ring\", after the simple aromatic compound benzene, or a phenyl group when part of a larger compound.\n\nNot all aromatic compounds are benzene-based; aromaticity can also manifest in heteroarenes, which follow Hückel's rule (for monocyclic rings: when the number of its π electrons equals 4n + 2, where n = 0, 1, 2, 3, ...). In these compounds, at least one carbon atom is replaced by one of the heteroatoms oxygen, nitrogen, or sulfur. Examples of non-benzene compounds with aromatic properties are furan, a heterocyclic compound with a five-membered ring that includes a single oxygen atom, and pyridine, a heterocyclic compound with a six-membered ring containing one nitrogen atom." . "application/ld+json" . "https://w3id.org/ro-id/0c470650-84d9-40e1-bc80-4591a27f6c4d" . "chemistry" . . "Aromatic compounds" . "MANUAL" . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . "Wolniewicz, Małgorzata. \"Aromatic compounds.\" ROHub. Jan 12 ,2022. https://w3id.org/ro-id/0c470650-84d9-40e1-bc80-4591a27f6c4d." . . . . "False" . . "2022-01-14 22:19:57.392548+00:00" . . . . "False" . . "2025-07-05 19:04:55.078129+00:00" . . . . "False" . . "2025-07-05 18:47:59.392957+00:00" . . . . "False" . . "2025-07-04 09:08:44.261623+00:00" . . . . "none" . . "Geographical Scope" . . . "arene" . . "4.658385093167703" . "4.5" . "User Needs (RAST)" . . . "Other Chemical Sciences" . . "none" . . "none" . . "none" . . "none" . . "Funding" . . . "none" . . "aromatic compound benzene" . . "13.168724279835391" . "6.4" . "chemical compound" . . "12.525879917184268" . "12.1" . "Key Type Measures" . . . "scent" . . "5.279503105590063" . "5.1" . "aromatic compounds aromatic compounds" . . "46.70781893004115" . "22.7" . "IPCC" . . . "carbon atom" . . "10.973084886128367" . "10.6" . "benzene" . . "12.224108658743631" . "7.2" . "aliphatic compound" . . "8.488964346349743" . "5.0" . "nitrogen" . . "4.244306418219462" . "4.1" . "electron" . . "4.244306418219462" . "4.1" . "Chemistry and materials (general)" . . "organic chemistry" . . "65.86151368760065" . "40.9" . "compound" . . "17.48726655348047" . "10.3" . "chemistry" . . "34.13848631239936" . "21.2" . "aromatic hydrocarbon" . . "7.979626485568759" . "4.7" . "Climate-ADAPT Adaptation Sectors" . . . "ring" . . "3.209109730848862" . "3.1" . "none" . . "Aromatic compounds Aromatic compounds are those chemical compounds (most commonly organic) that contain one or more rings with pi electrons delocalized all the way around them." . . "47.727272727272734" . "27.3" . "Chemicals" . . "heterocyclic compound" . . "6.521739130434784" . "6.3" . "carbon atom" . . "15.789473684210526" . "9.3" . "Chemical Sciences" . . "Climate Hazard" . . . "nitrogen atom" . . "18.51851851851852" . "9.0" . "larger compound" . . "10.493827160493826" . "5.1" . "Organic Chemistry" . . "none" . . "none" . . "aliphatic compound" . . "5.900621118012424" . "5.7" . "Organic chemical" . . "Economy, business and finance/Economic sector/Chemicals/Organic chemical" . "The term \"aromatic\" was assigned before the physical mechanism determining aromaticity was discovered, and referred simply to the fact that many such compounds have a sweet or pleasant odour; however, not all aromatic compounds have a sweet odour, and not all compounds with a sweet odour are aromatic compounds." . . "19.230769230769234" . "11.0" . "Chemistry and materials" . . "aromatic hydrocarbon" . . "5.693581780538303" . "5.5" . "Inorganic, organic and physical chemistry" . . "Methodology" . . . "Jewellery" . . "Arts, culture and entertainment/Arts and entertainment/Fashion/Jewellery" . "oxygen atom" . . "11.11111111111111" . "5.4" . "aromatic" . . "19.772256728778473" . "19.1" . "benzene" . . "9.316770186335406" . "9.0" . "heterocyclic compound" . . "9.507640067911712" . "5.6" . "The configuration of six carbon atoms in aromatic compounds is called a \"benzene ring\", after the simple aromatic compound benzene, or a phenyl group when part of a larger compound." . . "33.04195804195804" . "18.9" . "benzene ring" . . "3.4161490683229823" . "3.3" . "aromatic compound" . . "28.522920203735136" . "16.8" . "oxygen atom" . . "4.244306418219462" . "4.1" . "Knowledge Sector (EEA)" . . . "Stakeholders" . . . "none" . . "Policy Scale" . . . "service-account-enrichment" . . . "2026-05-19T13:49:44.836+02:00"^^ . . . . . . "Aromatic compounds" . "RSA" . "MIIBIjANBgkqhkiG9w0BAQEFAAOCAQ8AMIIBCgKCAQEAxszSDYX5tuCSkP7UiCtftYPFNQVTjgNu0I5fwdML2DLRDlp0xzmsQXRk8oHuvwGvG1aMjj6cpUqO+0rz2Sg/wvHOgUpkRH8VJXvmlkhafMLCMtUtk5JIx7e+fkzCby+fnmD7kMkGLrT+OaExWwEDmNlCAt0TPKcHSdwsjso2isXjtAsGevyCMke8ufnFYpjs746JES1eNzVnHnn2Kp/lqcm60GM+J8dLgRZp7fX0anW098xhKym6+xXFzqeju0vYRIHBPerv+r7skWxwk+a7Sd8msqVeYEv6NTqnyWvyWb6Yh8cvj04N6qm/T6C5FUPLQhzSaQgMVMU6yLqjPuu9DwIDAQAB" . "nnQuDfU99a8TAKR3RNMFG3mgxdvXDVUMtL000zvWy4lDjLNP1soC3WQzjFx/3q+Z+apxvzIPzHDoIZF/VcnhO9B6EEvNN9EmhAlTCZEp+x8l46VPQeW8EWJikaBhP5VcOHt4YdJerlghMC9DpBBlGpj0wci8qacKtOTbtcMi8qPh3N2r7ogaC1MZUGnodZL9Gy2y3CCCdr7hBeUL63ybp7SzzInTKuFaK8hVgVKDrY38ROOJrOex11NERLkSEYgfW74ECm5+udsdwmS/YVFdqPV2V9h/LTzzlZ/cx/URzE+BdtUfMm1bo5l3SR2IC+axpXcssQUhsIz5yDOWqCm1dQ==" . . . . . . . "" . "Earth sciences" . . "ISIDe Working Group" . . . "data span" . . "Dipartimento della Protezione Civile" . . "monitoring network" . "Dipartimento della Protezione Civile" . . "Creative Commons Attribution" . . . "Mt. Etna" . . "website" . . "data" . . "Italy" . . "seismicity" . . "Etna" . "Istituto Nazionale di Geofisica" . . . "Ro" . . "monitoring" . . "INGV website" . . "Internet" . . "Italy" . "POINT (14.9063 37.6002)" . . . "POINT (15.1897 37.793)" . . . "POINT (15.1075 37.711)" . . . "POINT (14.9805 37.8083)" . . . . "10f9db58-8991-4b1f-b552-35fbc6cb71df" . "POINT (15.1897 37.793)" . . "14.9063" . "37.6002" . "POINT (14.9063 37.6002)" . . . "53655fd9-abb3-4276-b2ff-d53bca6d3fad" . "POINT (14.9805 37.8083)" . . "15.1075" . "37.711" . "POINT (15.1075 37.711)" . . "15.1897" . "37.793" . "POINT (15.1897 37.793)" . . "14.9805" . "37.8083" . "POINT (14.9805 37.8083)" . . . "c1fb3e30-00ac-40ca-82ed-285f663b7fdf" . "POINT (14.9063 37.6002)" . . "service-account-enrichment" . . . "fa2c8fea-8cc9-44b7-9adc-b18ebfdd1b43" . "POINT (15.1075 37.711)" . . . . . . . . "54109"^^ . "https://api.rohub.org/api/ros/7dbe7eb1-c0c9-4722-ad47-885dd01eaee8/crate/download/" . . "2022-02-02 13:22:22.374580+00:00" . "2025-03-05 01:04:55.096466+00:00" . "2022-02-02 13:22:22.374580+00:00" . "This RO contains the seismicity occurring at Mt. Etna (Italy) from local and national monitoring networks managed by INGV. Data span of 12 days, 2016-07-06 - 2016-07-17 and it is taken from the INGV website. Data and results published on this website by Istituto Nazionale di Geofisica e Vulcanologia are licensed under a Creative Commons Attribution 4.0 International License. ISIDe Working Group at National Earthquake Observatory benefited from funding provided by the Italian Presidenza del Consiglio dei Ministri, Dipartimento della Protezione Civile." . "application/ld+json" . . . . "https://w3id.org/ro-id/7dbe7eb1-c0c9-4722-ad47-885dd01eaee8" . . "Mt. Etna (Italy) seismic activity from 2016-07-06 - 2016-07-17" . "AUTOMATIC" . "https://w3id.org/ro-id/7dbe7eb1-c0c9-4722-ad47-885dd01eaee8/3d0e7c5a-bedd-4802-aa5d-ae94adb6e1da" . "https://w3id.org/ro-id/7dbe7eb1-c0c9-4722-ad47-885dd01eaee8/86640593-6e89-4c59-9335-e875ce2e7e94" . "https://w3id.org/ro-id/7dbe7eb1-c0c9-4722-ad47-885dd01eaee8/c742e8e6-d19f-4d43-9ca8-db1807596aa7" . "https://w3id.org/ro-id/7dbe7eb1-c0c9-4722-ad47-885dd01eaee8/cff0fc1f-eaae-4657-978b-cadf35dbcf76" . . . . . . "Degassing" . "Etna Seismic Actitvity" . "Monitoring Networks" . "Seismic Activity" . "service-account-generation-service. \"Mt. Etna (Italy) seismic activity from 2016-07-06 - 2016-07-17.\" ROHub. Feb 02 ,2022. https://w3id.org/ro-id/7dbe7eb1-c0c9-4722-ad47-885dd01eaee8." . . . "Data" . . . "biblio" . . . . "49499"^^ . "https://api.rohub.org/api/resources/6fa21b20-d907-425d-9f50-88c998128b1e/download/" . . "2022-02-02 13:22:34.686024+00:00" . "2022-02-02 13:22:34.686925+00:00" . "image/png" . . "Sketch" . "2022-02-02 13:22:34.686024+00:00" . . . . . "14649"^^ . "https://api.rohub.org/api/resources/711ccdaa-7da2-435c-94b0-f8ddf68d395a/download/" . . "2022-02-02 13:22:27.784863+00:00" . "2022-02-02 13:22:27.785737+00:00" . "application/vnd.google-earth.kml+xml" . . "Seismic locations - kml" . "2022-02-02 13:22:27.784863+00:00" . . . . . "606"^^ . "https://api.rohub.org/api/resources/9b066a45-103f-46b9-bdd3-996acc663d93/download/" . . "2022-02-02 13:22:31.494399+00:00" . "2022-02-02 13:22:31.495365+00:00" . "text/plain" . . "Seismic locations - txt" . "2022-02-02 13:22:31.494399+00:00" . . . . . . . "service-account-generation-service" . . . "2026-05-19T13:48:30.638+02:00"^^ . . . . . "Mt. Etna (Italy) seismic activity from 2016-07-06 - 2016-07-17" . "RSA" . "MIIBIjANBgkqhkiG9w0BAQEFAAOCAQ8AMIIBCgKCAQEAxszSDYX5tuCSkP7UiCtftYPFNQVTjgNu0I5fwdML2DLRDlp0xzmsQXRk8oHuvwGvG1aMjj6cpUqO+0rz2Sg/wvHOgUpkRH8VJXvmlkhafMLCMtUtk5JIx7e+fkzCby+fnmD7kMkGLrT+OaExWwEDmNlCAt0TPKcHSdwsjso2isXjtAsGevyCMke8ufnFYpjs746JES1eNzVnHnn2Kp/lqcm60GM+J8dLgRZp7fX0anW098xhKym6+xXFzqeju0vYRIHBPerv+r7skWxwk+a7Sd8msqVeYEv6NTqnyWvyWb6Yh8cvj04N6qm/T6C5FUPLQhzSaQgMVMU6yLqjPuu9DwIDAQAB" . "g7c1VNMwh1sSul1eLbi7SltJPYQ2192oOfoHpXqYDKD1JUqSJDINMobjxvzmFWPKIrPJb3tzFXhQDSsteYpnFrWuKxS2ha97O/bjW/oVpEQoE0rlqq1xohvT5Bpfny3PeaLL1MKJ8265F738VkszLv5lX/6aud63COp4RKa9u4gYN15PqRGsamXeMEZOFW8hVsD7fQG2b+tgcs3il3hsiWvbixW9mfU+HT8bb9sOCWnrJA7a+D0DUduD8kwGgMjiT/mooM20DkE13/DfCbfZilo0m1krXHtj55rBmNE3SKH9yRWt9cKMROfDVDcmq55IJvB4cVlIY9qjVJ+rinNx0Q==" . . . . . . . "" . "Earth sciences" . . "ISIDe Working Group" . . . "data span" . . "Dipartimento della Protezione Civile" . . "monitoring network" . "Dipartimento della Protezione Civile" . . "Creative Commons Attribution" . . . "https://w3id.org/ro-id/8f442e85-5fef-4ac9-ba51-510ecb12b6e5/Mt.%20Etna" . . "website" . . "data" . . "Italy" . . "seismicity" . . "Etna" . "Istituto Nazionale di Geofisica" . . . "Ro" . . "monitoring" . . "INGV website" . . "Internet" . . "Italy" . "POINT (14.9557 37.6837)" . . . "POINT (14.9435 37.6752)" . . . "14.9435" . "37.6752" . "POINT (14.9435 37.6752)" . . "14.9557" . "37.6837" . "POINT (14.9557 37.6837)" . . . "d35ebce5-c992-4bcb-9b59-9aceec571bd2" . "POINT (14.9557 37.6837)" . . . "e2a11086-31fb-46e1-9d46-9b5dcd2368e9" . "POINT (14.9435 37.6752)" . . "service-account-enrichment" . . . . . . "50261"^^ . "https://api.rohub.org/api/ros/8f442e85-5fef-4ac9-ba51-510ecb12b6e5/crate/download/" . . "2022-02-02 13:23:00.765925+00:00" . "2025-03-05 01:04:55.534739+00:00" . "2022-02-02 13:23:00.765925+00:00" . "This RO contains the seismicity occurring at Mt. Etna (Italy) from local and national monitoring networks managed by INGV. Data span of 12 days, 2016-07-30 - 2016-08-10 and it is taken from the INGV website. Data and results published on this website by Istituto Nazionale di Geofisica e Vulcanologia are licensed under a Creative Commons Attribution 4.0 International License. ISIDe Working Group at National Earthquake Observatory benefited from funding provided by the Italian Presidenza del Consiglio dei Ministri, Dipartimento della Protezione Civile." . "application/ld+json" . . . . "https://w3id.org/ro-id/8f442e85-5fef-4ac9-ba51-510ecb12b6e5" . . "Mt. Etna (Italy) seismic activity from 2016-07-30 - 2016-08-10" . "AUTOMATIC" . "https://w3id.org/ro-id/8f442e85-5fef-4ac9-ba51-510ecb12b6e5/6335b778-a46a-452d-8b06-280671309547" . "https://w3id.org/ro-id/8f442e85-5fef-4ac9-ba51-510ecb12b6e5/9dc5ab51-8961-4f72-b28b-96f00a7cbb29" . . . . . . "Degassing" . "Etna Seismic Actitvity" . "Monitoring Networks" . "Seismic Activity" . "service-account-generation-service. \"Mt. Etna (Italy) seismic activity from 2016-07-30 - 2016-08-10.\" ROHub. Feb 02 ,2022. https://w3id.org/ro-id/8f442e85-5fef-4ac9-ba51-510ecb12b6e5." . . . "Data" . . . "biblio" . . . . "13565"^^ . "https://api.rohub.org/api/resources/268bca24-da87-4ee1-9914-ee87a39a5e0c/download/" . . "2022-02-02 13:23:04.933416+00:00" . "2022-02-02 13:23:04.934205+00:00" . "application/vnd.google-earth.kml+xml" . . "Seismic locations - kml" . "2022-02-02 13:23:04.933416+00:00" . . . . . "45584"^^ . "https://api.rohub.org/api/resources/8d4174be-b324-4ee4-80fa-d46e6d8fbce3/download/" . . "2022-02-02 13:23:12.296870+00:00" . "2022-02-02 13:23:12.297677+00:00" . "image/png" . . "Sketch" . "2022-02-02 13:23:12.296870+00:00" . . . . . "367"^^ . "https://api.rohub.org/api/resources/e4ffa5d4-891f-4864-81f0-61ab6ff7016a/download/" . . "2022-02-02 13:23:08.432203+00:00" . "2022-02-02 13:23:08.432976+00:00" . "text/plain" . . "Seismic locations - txt" . "2022-02-02 13:23:08.432203+00:00" . . . . . . . "service-account-generation-service" . . . "2026-05-19T13:48:30.348+02:00"^^ . . . . . "Mt. Etna (Italy) seismic activity from 2016-07-30 - 2016-08-10" . "RSA" . "MIIBIjANBgkqhkiG9w0BAQEFAAOCAQ8AMIIBCgKCAQEAxszSDYX5tuCSkP7UiCtftYPFNQVTjgNu0I5fwdML2DLRDlp0xzmsQXRk8oHuvwGvG1aMjj6cpUqO+0rz2Sg/wvHOgUpkRH8VJXvmlkhafMLCMtUtk5JIx7e+fkzCby+fnmD7kMkGLrT+OaExWwEDmNlCAt0TPKcHSdwsjso2isXjtAsGevyCMke8ufnFYpjs746JES1eNzVnHnn2Kp/lqcm60GM+J8dLgRZp7fX0anW098xhKym6+xXFzqeju0vYRIHBPerv+r7skWxwk+a7Sd8msqVeYEv6NTqnyWvyWb6Yh8cvj04N6qm/T6C5FUPLQhzSaQgMVMU6yLqjPuu9DwIDAQAB" . "cf+lDYpXT4310TjD8Zdv19OzkyQNF455DNDZtWuv3LpzI87sIM/l99zP22WfxoYb7+gVIv9HqliXFOOWfFA0lAa9hjj09TQzSIAJvJl8Px+OxlOc/hy3OcYIJzU0lqdJcYupokvIJtjYNKuCVgnTquer3YP77HF1UgkeIoNExOhJfqRMghTn04uCum4+/Ly7icrgzlgiLuXyqpxEJXcfW41ufGyoxQqIa/BKWDiquj1ImLoyn79bHzBKS/RplrLUB4bcwh64WuhRfUTeVHCtMHlb6jInRLguSOiWLdKCNfQYl207o18KCifP/e7s7uv4vFmLaO3Efj9SBUjf6H09Vg==" . . . . . . . "" . "Earth sciences" . . "ISIDe Working Group" . . . "data span" . . "Dipartimento della Protezione Civile" . . "monitoring network" . "Dipartimento della Protezione Civile" . . "Creative Commons Attribution" . . . "Mt. Etna" . . "website" . . "data" . . "Italy" . . "seismicity" . . "Etna" . "Istituto Nazionale di Geofisica" . . . "Ro" . . "monitoring" . . "INGV website" . . "Internet" . . "Italy" . "POINT (14.9513 37.8298)" . . . "14.9513" . "37.8298" . "POINT (14.9513 37.8298)" . . . "9303ad21-e095-4a8b-944e-76347e5c27c6" . "POINT (14.9513 37.8298)" . . "service-account-enrichment" . . . . . "46670"^^ . "https://api.rohub.org/api/ros/618c682d-22bf-4f4d-9fdb-3ca9196897a2/crate/download/" . . "2022-02-02 13:23:19.199340+00:00" . "2025-03-05 01:04:55.749971+00:00" . "2022-02-02 13:23:19.199340+00:00" . "This RO contains the seismicity occurring at Mt. Etna (Italy) from local and national monitoring networks managed by INGV. Data span of 12 days, 2016-08-11 - 2016-08-22 and it is taken from the INGV website. Data and results published on this website by Istituto Nazionale di Geofisica e Vulcanologia are licensed under a Creative Commons Attribution 4.0 International License. ISIDe Working Group at National Earthquake Observatory benefited from funding provided by the Italian Presidenza del Consiglio dei Ministri, Dipartimento della Protezione Civile." . "application/ld+json" . . . . "https://w3id.org/ro-id/618c682d-22bf-4f4d-9fdb-3ca9196897a2" . . "Mt. Etna (Italy) seismic activity from 2016-08-11 - 2016-08-22" . "AUTOMATIC" . "https://w3id.org/ro-id/618c682d-22bf-4f4d-9fdb-3ca9196897a2/0f6d8100-fa61-4557-99bb-82924ebc9a7d" . . . . . . "Degassing" . "Etna Seismic Actitvity" . "Monitoring Networks" . "Seismic Activity" . "service-account-generation-service. \"Mt. Etna (Italy) seismic activity from 2016-08-11 - 2016-08-22.\" ROHub. Feb 02 ,2022. https://w3id.org/ro-id/618c682d-22bf-4f4d-9fdb-3ca9196897a2." . . . "Data" . . . "biblio" . . . . "13019"^^ . "https://api.rohub.org/api/resources/529ba3b6-ab55-4a46-9d86-51a7e8ef8c88/download/" . . "2022-02-02 13:23:23.316237+00:00" . "2022-02-02 13:23:23.317209+00:00" . "application/vnd.google-earth.kml+xml" . . "Seismic locations - kml" . "2022-02-02 13:23:23.316237+00:00" . . . . . "254"^^ . "https://api.rohub.org/api/resources/7298b9d7-0696-423f-a4b4-28bf98d2ce53/download/" . . "2022-02-02 13:23:26.542196+00:00" . "2022-02-02 13:23:26.543388+00:00" . "text/plain" . . "Seismic locations - txt" . "2022-02-02 13:23:26.542196+00:00" . . . . . "43187"^^ . "https://api.rohub.org/api/resources/e70a2924-4465-403b-a450-51c0783fc5cd/download/" . . "2022-02-02 13:23:31.102326+00:00" . "2022-02-02 13:23:31.104047+00:00" . "image/png" . . "Sketch" . "2022-02-02 13:23:31.102326+00:00" . . . . . . . "service-account-generation-service" . . . "2026-05-19T13:48:30.013+02:00"^^ . . . . . "Mt. Etna (Italy) seismic activity from 2016-08-11 - 2016-08-22" . "RSA" . "MIIBIjANBgkqhkiG9w0BAQEFAAOCAQ8AMIIBCgKCAQEAxszSDYX5tuCSkP7UiCtftYPFNQVTjgNu0I5fwdML2DLRDlp0xzmsQXRk8oHuvwGvG1aMjj6cpUqO+0rz2Sg/wvHOgUpkRH8VJXvmlkhafMLCMtUtk5JIx7e+fkzCby+fnmD7kMkGLrT+OaExWwEDmNlCAt0TPKcHSdwsjso2isXjtAsGevyCMke8ufnFYpjs746JES1eNzVnHnn2Kp/lqcm60GM+J8dLgRZp7fX0anW098xhKym6+xXFzqeju0vYRIHBPerv+r7skWxwk+a7Sd8msqVeYEv6NTqnyWvyWb6Yh8cvj04N6qm/T6C5FUPLQhzSaQgMVMU6yLqjPuu9DwIDAQAB" . "PIni6m/iF6gkgpN3HSWKMOje4CXtX0Z2MYQ+YLzToRLXpxxZJrbH9SbpOewiyjlPcDfeOialaYTfxbJ4NKsiedLw2xrGgw6+8qSj5KLynYLz49+5egZMipVs5+bnBKoVxxCk0X+KDfZZidb0L2E04C9VAHdFb7w2jk9FG0SQYJfk/SS6KWSqsTYAHBA/B0706K0XrIeU4mHzSC8UHdBa0nhqe3ZFEuEDqe48um4DMIIVnH48onkce3tQQvOhdTtt9Ixupa7DJACra3GR2Vrn8oPzmtMI1xFXgMUhVtQh6RNitA2QD+l3Tv/h559Y6H59NhZTHr5iY3R5hfpP6THMeA==" . . . . . . . "" . "Mathematics" . . . "cohomology of the mod" . . "usage of the dataset" . . "mathematics" . . "minimal resolution" . . "algebra" . . "map" . . "mountain range" . . "document" . . "cohomology" . . "dataset" . . "range" . . "usage" . . "document CohomA2.pdf" . . "Steenrod algebra" . . "squaring" . . "resolution" . . "subject" . "service-account-enrichment" . . . . . "7227"^^ . "https://api.rohub.org/api/ros/ea70fc98-a80f-4758-8ae5-067ae64905ed/crate/download/" . . "2022-03-22 01:20:46.276139+00:00" . "2025-03-05 01:26:34.044209+00:00" . "2022-03-22 01:20:46.276139+00:00" . "The dataset contains a minimal resolution of the mod 2 Steenrod algebra in the range 0 <= s <= 128, 0 <= t <= 184, together with chain maps for each cocycle in that range and for the squaring operation Sq^0 in the cohomology of the Steenrod algebra. The included document CohomA2.pdf explains the contents and usage of the dataset in detail." . "application/ld+json" . . . . . "https://w3id.org/ro-id/ea70fc98-a80f-4758-8ae5-067ae64905ed" . . "The cohomology of the mod 2 Steenrod algebra" . "MANUAL" . . . . . . "Robert Bruner, and John Rognes. \"The cohomology of the mod 2 Steenrod algebra.\" ROHub. Mar 22 ,2022. https://w3id.org/ro-id/ea70fc98-a80f-4758-8ae5-067ae64905ed." . "biblio" . . . "raw data" . . . . "data" . . . "metadata" . . . . "https://archive.sigma2.no/pages/public/datasetDetail.jsf?id=10.11582/2021.00078" . . "2022-03-22 01:21:00.644689+00:00" . "2022-03-22 01:21:05.591782+00:00" . "The dataset contains a minimal resolution of the mod 2 Steenrod algebra in the range 0 <= s <= 128, 0 <= t <= 184, together with chain maps for each cocycle in that range and for the squaring operation Sq^0 in the cohomology of the Steenrod algebra. The included document CohomA2.pdf explains the contents and usage of the dataset in detail." . . "The cohomology of the mod 2 Steenrod algebra" . "2022-03-22 01:21:00.644689+00:00" . . . . . . . "Geo H." . . "john.rognes@rohub.com" . "John Rognes" . . "robert.bruner@rohub.com" . "Robert Bruner" . . . "2026-05-19T13:47:59.930+02:00"^^ . . . . . "The cohomology of the mod 2 Steenrod algebra" . "RSA" . "MIIBIjANBgkqhkiG9w0BAQEFAAOCAQ8AMIIBCgKCAQEAxszSDYX5tuCSkP7UiCtftYPFNQVTjgNu0I5fwdML2DLRDlp0xzmsQXRk8oHuvwGvG1aMjj6cpUqO+0rz2Sg/wvHOgUpkRH8VJXvmlkhafMLCMtUtk5JIx7e+fkzCby+fnmD7kMkGLrT+OaExWwEDmNlCAt0TPKcHSdwsjso2isXjtAsGevyCMke8ufnFYpjs746JES1eNzVnHnn2Kp/lqcm60GM+J8dLgRZp7fX0anW098xhKym6+xXFzqeju0vYRIHBPerv+r7skWxwk+a7Sd8msqVeYEv6NTqnyWvyWb6Yh8cvj04N6qm/T6C5FUPLQhzSaQgMVMU6yLqjPuu9DwIDAQAB" . "b3N3cMwvFGpk6n9zsF0K3kbbeYbml4O1ifgMBD+tyxFoc/KZ6r+z/gjMvxuLBhVDhrHwHtZUa3X0rYJw7SVm3YOkosIZTShuwiuT+PLtAbBh3oJItnLX1v7sRoqASH7RjuzUXlGrOIlWpi0EPGzB7CiAqN2ksBAS+8XTpZHk310sOlmExNgPT+HwFWzUOwPp9W3SWpA2e5QJWN9nsIlzWacHW2MywNFsT/IC5LwW6GEZJKMbW5yGyEL0XHBXu0ZvHkWrRV/1MUQAnVyGYRMFc4tH8wcLR9YexQqQXc4IqAP74kkPN60oKz/CwRu+1xwDgNpRfB3iBX4GLLkyN8KCKA==" . . . . . . . "" . "Mathematics" . . . "cohomology of the mod" . . "usage of the dataset" . . "mathematics" . . "minimal resolution" . . "algebra" . . "map" . . "mountain range" . . "document" . . "cohomology" . . "dataset" . . "range" . . "usage" . . "document CohomA2.pdf" . . "Steenrod algebra" . . "squaring" . . "resolution" . . "subject" . "service-account-enrichment" . . . . . "8675"^^ . "https://api.rohub.org/api/ros/32eba436-e9ef-4ed2-8911-fec14c5a3779/crate/download/" . . "2022-03-22 01:21:07.680973+00:00" . "2025-03-05 01:26:33.828703+00:00" . "2022-03-22 01:21:07.680973+00:00" . "The dataset contains a minimal resolution of the mod 2 Steenrod algebra in the range 0 <= s <= 128, 0 <= t <= 184, together with chain maps for each cocycle in that range and for the squaring operation Sq^0 in the cohomology of the Steenrod algebra. The included document CohomA2.pdf explains the contents and usage of the dataset in detail." . "application/ld+json" . . . . . "https://w3id.org/ro-id/32eba436-e9ef-4ed2-8911-fec14c5a3779" . . "The cohomology of the mod 2 Steenrod algebra" . "MANUAL" . . . . . . "Robert Bruner, and John Rognes. \"The cohomology of the mod 2 Steenrod algebra.\" ROHub. Mar 22 ,2022. https://w3id.org/ro-id/32eba436-e9ef-4ed2-8911-fec14c5a3779." . "raw data" . . . "biblio" . . . . "data" . . . "metadata" . . . "Bruner, R., Rognes, J. (2022).The cohomology of the mod 2 Steenrod algebra [Data set]. Norstore. https://doi.org/10.11582/2022.00015" . "Robert Ray Bruner" . "Observation" . . "https://archive.sigma2.no/pages/public/datasetDetail.jsf?id=10.11582/2021.00077" . . "None" . "2022-03-22 01:21:29.913760+00:00" . "The dataset contains a minimal resolution of the mod 2 Steenrod algebra in the range 0 <= s <= 128, 0 <= t <= 184, together with chain maps for each cocycle in that range and for the squaring operation Sq^0 in the cohomology of the Steenrod algebra. The included document CohomA2.pdf explains the contents and usage of the dataset in detail." . . "The cohomology of the mod 2 Steenrod algebra" . "None" . . . . "Robert Ray Bruner" . . . . "Geo H." . . "john.rognes@rohub.com" . "John Rognes" . . "robert.bruner@rohub.com" . "Robert Bruner" . . . "2026-05-19T13:47:59.672+02:00"^^ . . . . . "The cohomology of the mod 2 Steenrod algebra" . "RSA" . "MIIBIjANBgkqhkiG9w0BAQEFAAOCAQ8AMIIBCgKCAQEAxszSDYX5tuCSkP7UiCtftYPFNQVTjgNu0I5fwdML2DLRDlp0xzmsQXRk8oHuvwGvG1aMjj6cpUqO+0rz2Sg/wvHOgUpkRH8VJXvmlkhafMLCMtUtk5JIx7e+fkzCby+fnmD7kMkGLrT+OaExWwEDmNlCAt0TPKcHSdwsjso2isXjtAsGevyCMke8ufnFYpjs746JES1eNzVnHnn2Kp/lqcm60GM+J8dLgRZp7fX0anW098xhKym6+xXFzqeju0vYRIHBPerv+r7skWxwk+a7Sd8msqVeYEv6NTqnyWvyWb6Yh8cvj04N6qm/T6C5FUPLQhzSaQgMVMU6yLqjPuu9DwIDAQAB" . "sJNoKdi4IFuYO4335Mi8YiTp+rFEMzBjw6DIIASbjGFWn2kM9mFkdIcD5wlChsohTNUe7TK3Bpnr1hQ3G89e/Vtsxheg1YKfni84nPZMqJ9VtVG3fZu3a0Chzc3vjFpwn+o92fADAKC/BhBSbqbYlAR11EFcDJ4zgP7WImtDwrrKU8wvcGE1Cgz5seM8dSVp3Mkl1m2CeOVSaLz3SgUBzV3CE0bZN7BWNoP3pQcJiGlNljJOMRpr4SV4knNw+ShpfVhuKFzvNl+c9HnclDha2Oo0ilnfYzWk73G2gdn9qI7C5JZGk6tuQ0VtLcnfCQbxpQRKevNF1HbFrRNwN8jhCA==" . . . . . . . "" . "Environmental research" . . "" . "Life sciences" . . "" . "Physical sciences" . . "" . "Biology" . . . "Svalbard" . . "time series station" . . "West Spitsbergen Current" . . "West Spitsbergen Current" . . "ecology" . . "Atlantic Ocean" . . "mouth of Adventfjorden" . . "Atlantic water" . . "hydrography" . . "ecosystem" . . "time series" . . "dataset" . . "stream mouth" . . "broadcasting station" . . "Spitsbergen" . . "inflow" . . "Atlantic Ocean" . . "ecosystem effects of climate change" . . "effects of climate change" . . "Spitsbergen" . . "station" . . "variability" . "15.52992" . "78.26105" . "POINT (15.52992 78.26105)" . . . "c9a6edac-883c-4415-aad5-5270dff5e8fb" . "POINT (15.52992 78.26105)" . . "service-account-enrichment" . . . . . . . . "6795"^^ . "https://api.rohub.org/api/ros/1b7874e4-6c2f-4b84-87cb-74db13d49196/crate/download/" . . "2022-03-22 01:21:31.715074+00:00" . "2025-03-05 01:01:11.704641+00:00" . "2022-03-22 01:21:31.715074+00:00" . "The Isfjorden-Adventfjorden (IsA) time series station is a marine station operated by the University Centre in Svalbard (UNIS). It is located in the mouth of Adventfjorden within Isfjorden on the west coast of Spitsbergen, and is frequently influenced by inflow of warm Atlantic Water from the West Spitsbergen Current. The station is therefore well suited for monitoring seasonal variability and ecosystem effects of climate change. IsA has been sampled on a monthly basis since December 2011. This dataset represents the acid-corrected Chl a values from several depths." . "application/ld+json" . . . . . "https://w3id.org/ro-id/1b7874e4-6c2f-4b84-87cb-74db13d49196" . . "ISA_Svalbard_Chlorophyll_A_2011_2019" . "MANUAL" . "https://w3id.org/ro-id/1b7874e4-6c2f-4b84-87cb-74db13d49196/870010a7-224a-4b80-8ee6-bcdb220e619e" . . . . . . "University Centre in Svalbard (UNIS). \"ISA_Svalbard_Chlorophyll_A_2011_2019.\" ROHub. Mar 22 ,2022. https://w3id.org/ro-id/1b7874e4-6c2f-4b84-87cb-74db13d49196." . "POINT (15.52992 78.26105)" . . . "raw data" . . . . "data" . . . "metadata" . . . "biblio" . . . . "https://archive.sigma2.no/pages/public/datasetDetail.jsf?id=10.11582/2021.00069" . . "2022-03-22 01:21:41.637352+00:00" . "2022-03-22 01:21:46.049432+00:00" . "The Isfjorden-Adventfjorden (IsA) time series station is a marine station operated by the University Centre in Svalbard (UNIS). It is located in the mouth of Adventfjorden within Isfjorden on the west coast of Spitsbergen, and is frequently influenced by inflow of warm Atlantic Water from the West Spitsbergen Current. The station is therefore well suited for monitoring seasonal variability and ecosystem effects of climate change. IsA has been sampled on a monthly basis since December 2011. This dataset represents the acid-corrected Chl a values from several depths." . . "ISA_Svalbard_Chlorophyll_A_2011_2019" . "2022-03-22 01:21:41.637352+00:00" . . . . . . . "UNIS@rohub.com" . "University Centre in Svalbard (UNIS)" . . "Geo H." . . . "2026-05-19T13:47:59.317+02:00"^^ . . . . . "ISA_Svalbard_Chlorophyll_A_2011_2019" . "RSA" . "MIIBIjANBgkqhkiG9w0BAQEFAAOCAQ8AMIIBCgKCAQEAxszSDYX5tuCSkP7UiCtftYPFNQVTjgNu0I5fwdML2DLRDlp0xzmsQXRk8oHuvwGvG1aMjj6cpUqO+0rz2Sg/wvHOgUpkRH8VJXvmlkhafMLCMtUtk5JIx7e+fkzCby+fnmD7kMkGLrT+OaExWwEDmNlCAt0TPKcHSdwsjso2isXjtAsGevyCMke8ufnFYpjs746JES1eNzVnHnn2Kp/lqcm60GM+J8dLgRZp7fX0anW098xhKym6+xXFzqeju0vYRIHBPerv+r7skWxwk+a7Sd8msqVeYEv6NTqnyWvyWb6Yh8cvj04N6qm/T6C5FUPLQhzSaQgMVMU6yLqjPuu9DwIDAQAB" . "dSynof9IG1I3xmR8/aQZ6yG/rHaibuMlzYh26pz8NGQBCjcAn8tsbKqbCti8mpuZTWW24njvbK48YPZfPwFIaDXc8xRkIf5/mC5tMrlH0mlJrzi7iyEU8U4zDkl1nTV8tM0mjaEZsXAD0gG1aNBLqta4M3b78YkCMqbNl+ILGMa+u01XJiIQuXuAD0yW0CdDCxMk0JxBnuuKs1/RYwkGpaLjwfBdRtwYKShC5m3UwQV6Lc4rsE5UYHXYu/ULUSN8OILXFIbs0fqQTjZiDfUoXPxoPJchN85AaOnyqOY89/luji0/jxKlf/uPNQyMiAWY2Ms/JR5LLwWwvYzZE6dewA==" . . . . . . . "" . "Environmental research" . . "" . "Life sciences" . . "" . "Physical sciences" . . "" . "Earth sciences" . . . "Svalbard" . . "temperature logger" . . "physics" . . "medicine" . . "temperature" . . "processing" . . "observatory" . . "fluorescence" . . "diagram" . . "dataset" . . "recovery" . . "moor" . . "Svalbard" . . "mooring diagram" . . "fluorescence data" . . "observatory layout" . . "marine biology" . . "logger" . . "layout" . . "information" . . "watercraft and nautical navigation" . "UiT The Arctic University of Norway and The" . . "Scottish Association" . . . "observatories consist" . . "occupational overuse syndrome" . "11.8239" . "78.9589" . "POINT (11.8239 78.9589)" . . . "bece0544-4961-412d-91ad-ecf25c63d637" . "POINT (11.8239 78.9589)" . . "service-account-enrichment" . . . . . . . . . . . . . . . "11468"^^ . "https://api.rohub.org/api/ros/b4960d2f-d2a6-462c-83b1-9b85f4c046ac/crate/download/" . . "2022-03-22 01:21:47.502650+00:00" . "2025-03-05 01:24:10.636796+00:00" . "2022-03-22 01:21:47.502650+00:00" . "As part of the \"KROP - Kongsfjorden Rijpfjorden Observatory Programme\" UiT The Arctic University of Norway and The Scottish Association for Marine Science maintain marine observatories (moorings) in two high-Arctic fjords in Svalbard: Kongsfjorden and Rijpfjorden. The observatories consists of an array of CTDs, temperature loggers, ADCPs and a sediment trap, in addition to various other instruments or installations that change from year to year. \nThis dataset contains the CTD, PAR and fluorescence data from Kongsfjorden 2017-2018. \nFluorescence data is given as raw voltage only, due to calibration and fouling issues. It is meant as an indication of the timing of the phytoplankton bloom, not as absolute chlorophyll a concentration. \nNo post-recovery processing of light data (to correct for fouling) has been performed. \nThe observatory layout is available in the mooring diagram provided." . "application/ld+json" . . . . . "https://w3id.org/ro-id/b4960d2f-d2a6-462c-83b1-9b85f4c046ac" . . "Temperature, salinity, light and fluorescence (CTD) measurements from the Kongsfjorden (Svalbard) marine observatory (mooring) August 2017-August 2018" . "MANUAL" . "https://w3id.org/ro-id/b4960d2f-d2a6-462c-83b1-9b85f4c046ac/1815b2b8-8a48-4223-a69b-52dcee7b0fca" . . . . . . "Finlo Cottier, Jørgen Berge, Estelle Dumont, Tomasz Piotr Kopec, Emily Joanne Venables, Daniel Ludwig Vogedes, UiT The Arctic University of Norway (UiT), and Scottish Association for Marine Science (SAMS). \"Temperature, salinity, light and fluorescence (CTD) measurements from the Kongsfjorden (Svalbard) marine observatory (mooring) August 2017-August 2018.\" ROHub. Mar 22 ,2022. https://w3id.org/ro-id/b4960d2f-d2a6-462c-83b1-9b85f4c046ac." . "POINT (11.8239 78.9589)" . . . . "data" . . . "biblio" . . . "metadata" . . . "raw data" . . . "Cottier, F., Berge, J., Dumont, E., Kopec, T. P., Venables, E. J., Vogedes, D. L., UiT The Arctic University of Norway, Scottish Association for Marine Science (2021).Temperature, salinity, light and fluorescence (CTD) measurements from the Kongsfjorden (Svalbard) marine observatory (mooring) August 2017-August 2018 [Data set]. Norstore. https://doi.org/10.11582/2021.00065" . "UiT The Arctic University of Norway (UiT)" . "Observation" . . "https://archive.sigma2.no/pages/public/datasetDetail.jsf?id=10.11582/2021.00065" . . "2021-07-16 00:00:00" . "2022-03-22 01:22:40.368999+00:00" . "As part of the \"KROP - Kongsfjorden Rijpfjorden Observatory Programme\" UiT The Arctic University of Norway and The Scottish Association for Marine Science maintain marine observatories (moorings) in two high-Arctic fjords in Svalbard: Kongsfjorden and Rijpfjorden. The observatories consists of an array of CTDs, temperature loggers, ADCPs and a sediment trap, in addition to various other instruments or installations that change from year to year. \nThis dataset contains the CTD, PAR and fluorescence data from Kongsfjorden 2017-2018. \nFluorescence data is given as raw voltage only, due to calibration and fouling issues. It is meant as an indication of the timing of the phytoplankton bloom, not as absolute chlorophyll a concentration. \nNo post-recovery processing of light data (to correct for fouling) has been performed. \nThe observatory layout is available in the mooring diagram provided." . . "Temperature, salinity, light and fluorescence (CTD) measurements from the Kongsfjorden (Svalbard) marine observatory (mooring) August 2017-August 2018" . "2021-07-16 00:00:00" . . . . "Daniel Ludwig Vogedes" . . . . "SAMS@rohub.com" . "Scottish Association for Marine Science (SAMS)" . . "UiT@rohub.com" . "UiT The Arctic University of Norway (UiT)" . . "daniel.ludwig.vogedes@rohub.com" . "Daniel Ludwig Vogedes" . . "emily.joanne.venables@rohub.com" . "Emily Joanne Venables" . . "estelle.dumont@rohub.com" . "Estelle Dumont" . . "finlo.cottier@rohub.com" . "Finlo Cottier" . . "Geo H." . . "jorgen.berge@rohub.com" . "Jørgen Berge" . . "tomasz.piotr.kopec@rohub.com" . "Tomasz Piotr Kopec" . . . "2026-05-19T13:47:58.920+02:00"^^ . . . . . "Temperature, salinity, light and fluorescence (CTD) measurements from the Kongsfjorden (Svalbard) marine observatory (mooring) August 2017-August 2018" . "RSA" . "MIIBIjANBgkqhkiG9w0BAQEFAAOCAQ8AMIIBCgKCAQEAxszSDYX5tuCSkP7UiCtftYPFNQVTjgNu0I5fwdML2DLRDlp0xzmsQXRk8oHuvwGvG1aMjj6cpUqO+0rz2Sg/wvHOgUpkRH8VJXvmlkhafMLCMtUtk5JIx7e+fkzCby+fnmD7kMkGLrT+OaExWwEDmNlCAt0TPKcHSdwsjso2isXjtAsGevyCMke8ufnFYpjs746JES1eNzVnHnn2Kp/lqcm60GM+J8dLgRZp7fX0anW098xhKym6+xXFzqeju0vYRIHBPerv+r7skWxwk+a7Sd8msqVeYEv6NTqnyWvyWb6Yh8cvj04N6qm/T6C5FUPLQhzSaQgMVMU6yLqjPuu9DwIDAQAB" . "SuFn90pqfK0oNi7Kv9C5RwljkQYSdboIx8oDmo4aU//Rwz9PFSQ/LG3gBtrMsWlWM4/nmZikT0bSkkcbVrCW77ZOc784pyVGQYFjd5GObqDHc9zDQmwMgxrqeKLPOT96my5HGPHtPTbT+yG8+iZOhEFIKU1gmqA2eyu6Gf6EPqxx3GrHSju6HNaavq1nLexT15X38EVjiBcK/5H3gFlmNeBj+fmx1P55wjEhYSZup13XLGA9ts834AZkGWzi1u1egycS5OhQ/AbBepQv6FFFEc27Ef1NE0FcHrNmJPStkvQit3KP5dMrqAIzmYtgoluzNgXJl7hPHMLNLv6P6FDzpw==" . . . . . . . "" . "Environmental research" . . "" . "Life sciences" . . "" . "Physical sciences" . . "" . "Earth sciences" . . "11.8237" . "78.9592" . "POINT (11.8237 78.9592)" . . . "6dbca1e0-2173-4f1d-b61e-f4e28bec383e" . "POINT (11.8237 78.9592)" . . "service-account-enrichment" . . . . . . . . . . . . . . . "11480"^^ . "https://api.rohub.org/api/ros/04c3f1b2-96ec-4065-98a1-9499762d2405/crate/download/" . . "2022-03-22 01:22:41.914748+00:00" . "2025-03-05 01:24:10.453697+00:00" . "2022-03-22 01:22:41.914748+00:00" . "As part of the \"KROP - Kongsfjorden Rijpfjorden Observatory Programme\" UiT The Arctic University of Norway and The Scottish Association for Marine Science maintain marine observatories (moorings) in two high-Arctic fjords in Svalbard: Kongsfjorden and Rijpfjorden. The observatories consists of an array of CTDs, temperature loggers, ADCPs and a sediment trap, in addition to various other instruments or installations that change from year to year. \nThis dataset contains the CTD, PAR and fluorescence data from Kongsfjorden 2016-2017. \nFluorescence data is given as raw voltage only, due to calibration and fouling issues. It is meant as an indication of the timing of the phytoplankton bloom, not as absolute chlorophyll a concentration. \nNo post-recovery processing of light data (to correct for fouling) has been performed. \nThe observatory layout is available in the mooring diagram provided. \nAt this deployment, two settlement plates were deployed (25m and 208m)." . "application/ld+json" . . . . . "https://w3id.org/ro-id/04c3f1b2-96ec-4065-98a1-9499762d2405" . . "Temperature, salinity, light and fluorescence (CTD) measurements from the Kongsfjorden (Svalbard) marine observatory (mooring) August 2016-August 2017" . "MANUAL" . "Svalbard" . "dataset" . "diagram" . "fluorescence" . "information" . "layout" . "mooring" . "observatory" . "occupational overuse syndrome" . "processing" . "recovery" . "temperature" . "earth sciences" . "CTD" . "Kongsfjorden Rijpfjorden Observatory Programme" . "data" . "diagram" . "fluorescence" . "mooring" . "observatory" . "space sciences" . "fluorescence data" . "mooring diagram" . "observatories consist" . "observatory layout" . "recovery processing" . "As part of the \"KROP - Kongsfjorden Rijpfjorden Observatory Programme\" UiT The Arctic University of Norway and The Scottish Association for Marine Science maintain marine observatories (moorings) in two high-Arctic fjords in Svalbard: Kongsfjorden and Rijpfjorden." . "The observatory layout is available in the mooring diagram provided." . "This dataset contains the CTD, PAR and fluorescence data from Kongsfjorden 2016-2017." . "2016-2017" . "Aug-2016-Aug-2017" . "https://w3id.org/ro-id/04c3f1b2-96ec-4065-98a1-9499762d2405/43a67b20-7c3d-4cd5-b299-35283289cf7f" . . . . . . "armed forces" . "medicine" . "physics" . "Svalbard" . "Finlo Cottier, Jørgen Berge, Estelle Dumont, Colin Griffith, John Beaton, Daniel Ludwig Vogedes, UiT The Arctic University of Norway (UiT), and Scottish Association for Marine Science (SAMS). \"Temperature, salinity, light and fluorescence (CTD) measurements from the Kongsfjorden (Svalbard) marine observatory (mooring) August 2016-August 2017.\" ROHub. Mar 22 ,2022. https://w3id.org/ro-id/04c3f1b2-96ec-4065-98a1-9499762d2405." . "POINT (11.8237 78.9592)" . . . "metadata" . . . "raw data" . . . "biblio" . . . . "data" . . . "Cottier, F., Berge, J., Dumont, E., Griffith, C., Beaton, J., Vogedes, D. L., UiT The Arctic University of Norway, Scottish Association for Marine Science (2021).Temperature, salinity, light and fluorescence (CTD) measurements from the Kongsfjorden (Svalbard) marine observatory (mooring) August 2016-August 2017 [Data set]. Norstore. https://doi.org/10.11582/2021.00062" . "UiT The Arctic University of Norway (UiT)" . "Observation" . . "https://archive.sigma2.no/pages/public/datasetDetail.jsf?id=10.11582/2021.00062" . . "2021-07-12 00:00:00" . "2022-03-22 01:23:32.132406+00:00" . "As part of the \"KROP - Kongsfjorden Rijpfjorden Observatory Programme\" UiT The Arctic University of Norway and The Scottish Association for Marine Science maintain marine observatories (moorings) in two high-Arctic fjords in Svalbard: Kongsfjorden and Rijpfjorden. The observatories consists of an array of CTDs, temperature loggers, ADCPs and a sediment trap, in addition to various other instruments or installations that change from year to year. \nThis dataset contains the CTD, PAR and fluorescence data from Kongsfjorden 2016-2017. \nFluorescence data is given as raw voltage only, due to calibration and fouling issues. It is meant as an indication of the timing of the phytoplankton bloom, not as absolute chlorophyll a concentration. \nNo post-recovery processing of light data (to correct for fouling) has been performed. \nThe observatory layout is available in the mooring diagram provided. \nAt this deployment, two settlement plates were deployed (25m and 208m)." . . "Temperature, salinity, light and fluorescence (CTD) measurements from the Kongsfjorden (Svalbard) marine observatory (mooring) August 2016-August 2017" . "2021-07-12 00:00:00" . . . . "Daniel Ludwig Vogedes" . . . . "SAMS@rohub.com" . "Scottish Association for Marine Science (SAMS)" . . "UiT@rohub.com" . "UiT The Arctic University of Norway (UiT)" . . "colin.griffith@rohub.com" . "Colin Griffith" . . "daniel.ludwig.vogedes@rohub.com" . "Daniel Ludwig Vogedes" . . "estelle.dumont@rohub.com" . "Estelle Dumont" . . "finlo.cottier@rohub.com" . "Finlo Cottier" . . "Geo H." . . "john.beaton@rohub.com" . "John Beaton" . . "jorgen.berge@rohub.com" . "Jørgen Berge" . . . "2026-05-19T13:47:58.543+02:00"^^ . . . . . "Temperature, salinity, light and fluorescence (CTD) measurements from the Kongsfjorden (Svalbard) marine observatory (mooring) August 2016-August 2017" . "RSA" . "MIIBIjANBgkqhkiG9w0BAQEFAAOCAQ8AMIIBCgKCAQEAxszSDYX5tuCSkP7UiCtftYPFNQVTjgNu0I5fwdML2DLRDlp0xzmsQXRk8oHuvwGvG1aMjj6cpUqO+0rz2Sg/wvHOgUpkRH8VJXvmlkhafMLCMtUtk5JIx7e+fkzCby+fnmD7kMkGLrT+OaExWwEDmNlCAt0TPKcHSdwsjso2isXjtAsGevyCMke8ufnFYpjs746JES1eNzVnHnn2Kp/lqcm60GM+J8dLgRZp7fX0anW098xhKym6+xXFzqeju0vYRIHBPerv+r7skWxwk+a7Sd8msqVeYEv6NTqnyWvyWb6Yh8cvj04N6qm/T6C5FUPLQhzSaQgMVMU6yLqjPuu9DwIDAQAB" . "TLl+j0FxVycq+BFvpJYXU0Iz4mKCyHfGpXxxMAf59cnIns0qv/fHsUyIoxjoHIhEc5EjPLEJz20kdujPGhTOztpHuVGqUght+D7omu+Uy/HyxCo99bSoydV5ZrKxmaftDXN39wWMn1eER5wQT9wXwH0NXRj0nHzPLoUjaqX+7o0WwBG7QMmpPer9AUAp49YjWFh319zWY9Eu/BZFQ6Srr2ltz10tJx/88QMUrWbVYlccTiTeTVv7gT+JQNcNiwk+RbxSgWI5ylQ9EJg2jDLplNZ75N0wtJ8iG1N0tNPx3xT7DnuCTu+s2/lzinj5PzbbGC1I/QPUrxcV88P/AB6iqA==" . . . . . . . "" . "Environmental research" . . "" . "Life sciences" . . "" . "Physical sciences" . . "" . "Earth sciences" . . . "40e24f2d-a1b1-42dd-ba2e-eedfdfeea4ec" . "POINT (11.8238 78.9589)" . . "11.8238" . "78.9589" . "POINT (11.8238 78.9589)" . . "service-account-enrichment" . . . . . . . . . . . . . . . "11633"^^ . "https://api.rohub.org/api/ros/868972b2-e340-4007-8521-8f03b58cb7b9/crate/download/" . . "2022-03-22 01:23:33.372212+00:00" . "2025-03-05 01:24:10.793750+00:00" . "2022-03-22 01:23:33.372212+00:00" . "As part of the \"KROP - Kongsfjorden Rijpfjorden Observatory Programme\" UiT The Arctic University of Norway and The Scottish Association for Marine Science maintain marine observatories (moorings) in two high-Arctic fjords in Svalbard: Kongsfjorden and Rijpfjorden. The observatories consists of an array of CTDs, temperature loggers, ADCPs and a sediment trap, in addition to various other instruments or installations that change from year to year. \nThis dataset contains the CTD, PAR and fluorescence data from Kongsfjorden 2015-2016. \nFluorescence data is given as raw voltage only, due to calibration and fouling issues. It is meant as an indication of the timing of the phytoplankton bloom, not as absolute chlorophyll a concentration. \nNo post-recovery processing of light data (to correct for fouling) has been performed. \nThe observatory layout is available in the mooring diagram provided. \nFor this deployment a RAS500 water sampler and a SUNA nitrate sensor were deployed for a specific project, data are not part of the long-term monitoring efforts and are available upon request." . "application/ld+json" . . . . . "https://w3id.org/ro-id/868972b2-e340-4007-8521-8f03b58cb7b9" . . "Temperature, salinity, light and fluorescence (CTD) measurements from the Kongsfjorden (Svalbard) marine observatory (mooring) September 2015-August 2016" . "MANUAL" . "Svalbard" . "data" . "dataset" . "diagram" . "fluorescence" . "information" . "mooring" . "nitrate" . "observatory" . "occupational overuse syndrome" . "sampler" . "sensor" . "temperature" . "earth sciences" . "CTD" . "Kongsfjorden Rijpfjorden Observatory Programme" . "data" . "diagram" . "fluorescence" . "mooring" . "observatory" . "space sciences" . "SUNA nitrate sensor" . "fluorescence data" . "mooring diagram" . "observatories consist" . "observatory layout" . "As part of the \"KROP - Kongsfjorden Rijpfjorden Observatory Programme\" UiT The Arctic University of Norway and The Scottish Association for Marine Science maintain marine observatories (moorings) in two high-Arctic fjords in Svalbard: Kongsfjorden and Rijpfjorden." . "The observatory layout is available in the mooring diagram provided." . "This dataset contains the CTD, PAR and fluorescence data from Kongsfjorden 2015-2016." . "2015-2016" . "Sep-2015-Aug-2016" . "https://w3id.org/ro-id/868972b2-e340-4007-8521-8f03b58cb7b9/f68b0cde-9eb9-4e5e-a13e-f980ee3ccbf5" . . . . . . "armed forces" . "marine biology" . "medicine" . "physics" . "Svalbard" . "Finlo Cottier, Jørgen Berge, Colin Griffith, Estelle Dumont, John Beaton, Daniel Ludwig Vogedes, UiT The Arctic University of Norway (UiT), and Scottish Association for Marine Science (SAMS). \"Temperature, salinity, light and fluorescence (CTD) measurements from the Kongsfjorden (Svalbard) marine observatory (mooring) September 2015-August 2016.\" ROHub. Mar 22 ,2022. https://w3id.org/ro-id/868972b2-e340-4007-8521-8f03b58cb7b9." . "POINT (11.8238 78.9589)" . . . "metadata" . . . "biblio" . . . "raw data" . . . . "data" . . . "Cottier, F., Berge, J., Griffith, C., Dumont, E., Beaton, J., Vogedes, D. L., UiT The Arctic University of Norway, Scottish Association for Marine Science (2021).Temperature, salinity, light and fluorescence (CTD) measurements from the Kongsfjorden (Svalbard) marine observatory (mooring) September 2015-August 2016 [Data set]. Norstore. https://doi.org/10.11582/2021.00061" . "Daniel Ludwig Vogedes" . "Observation" . . "https://archive.sigma2.no/pages/public/datasetDetail.jsf?id=10.11582/2021.00061" . . "2021-07-12 00:00:00" . "2022-03-22 01:24:23.830029+00:00" . "As part of the \"KROP - Kongsfjorden Rijpfjorden Observatory Programme\" UiT The Arctic University of Norway and The Scottish Association for Marine Science maintain marine observatories (moorings) in two high-Arctic fjords in Svalbard: Kongsfjorden and Rijpfjorden. The observatories consists of an array of CTDs, temperature loggers, ADCPs and a sediment trap, in addition to various other instruments or installations that change from year to year. \nThis dataset contains the CTD, PAR and fluorescence data from Kongsfjorden 2015-2016. \nFluorescence data is given as raw voltage only, due to calibration and fouling issues. It is meant as an indication of the timing of the phytoplankton bloom, not as absolute chlorophyll a concentration. \nNo post-recovery processing of light data (to correct for fouling) has been performed. \nThe observatory layout is available in the mooring diagram provided. \nFor this deployment a RAS500 water sampler and a SUNA nitrate sensor were deployed for a specific project, data are not part of the long-term monitoring efforts and are available upon request." . . "Temperature, salinity, light and fluorescence (CTD) measurements from the Kongsfjorden (Svalbard) marine observatory (mooring) September 2015-August 2016" . "2021-07-12 00:00:00" . . . . "Daniel Ludwig Vogedes" . . . . "SAMS@rohub.com" . "Scottish Association for Marine Science (SAMS)" . . "UiT@rohub.com" . "UiT The Arctic University of Norway (UiT)" . . "colin.griffith@rohub.com" . "Colin Griffith" . . "daniel.ludwig.vogedes@rohub.com" . "Daniel Ludwig Vogedes" . . "estelle.dumont@rohub.com" . "Estelle Dumont" . . "finlo.cottier@rohub.com" . "Finlo Cottier" . . "Geo H." . . "john.beaton@rohub.com" . "John Beaton" . . "jorgen.berge@rohub.com" . "Jørgen Berge" . . . "2026-05-19T13:47:58.228+02:00"^^ . . . . . "Temperature, salinity, light and fluorescence (CTD) measurements from the Kongsfjorden (Svalbard) marine observatory (mooring) September 2015-August 2016" . "RSA" . "MIIBIjANBgkqhkiG9w0BAQEFAAOCAQ8AMIIBCgKCAQEAxszSDYX5tuCSkP7UiCtftYPFNQVTjgNu0I5fwdML2DLRDlp0xzmsQXRk8oHuvwGvG1aMjj6cpUqO+0rz2Sg/wvHOgUpkRH8VJXvmlkhafMLCMtUtk5JIx7e+fkzCby+fnmD7kMkGLrT+OaExWwEDmNlCAt0TPKcHSdwsjso2isXjtAsGevyCMke8ufnFYpjs746JES1eNzVnHnn2Kp/lqcm60GM+J8dLgRZp7fX0anW098xhKym6+xXFzqeju0vYRIHBPerv+r7skWxwk+a7Sd8msqVeYEv6NTqnyWvyWb6Yh8cvj04N6qm/T6C5FUPLQhzSaQgMVMU6yLqjPuu9DwIDAQAB" . "typ/0NP8HhXAmtFbbSjJ418rh0mjHJjgDEoCg7OQ0mvWC1Vprv8OzeHKSrMT4yhlHC2LHoZW0PO9EWNu2RKwS6WtyCfBfyo3YlD6BRmxaOHhVvP2ikiaG4IEKSOmv3n9klEJQlouz2Pq4zN3kgiyihLKDugRoWiuSgrbTMUXgjRwh0YbRehJZ9Ezb5pUihOvWFKzGq4XdMq8KcbtA6odM45n0jd0wL8GRBoGW77T0sR5Asd9NH2Axo4U3+8PRAKsUFZvqh2JA33c1isL6Y1eF+GK8YB7HWm98FVd4YlPOB/Ky+NBsMlDBLUaGbBde6Jgvd5fCZ9JP/2kcmwgTrvAsw==" . . . . . . . "" . "Environmental research" . . "" . "Life sciences" . . "" . "Physical sciences" . . . "Svalbard" . "National Institute of Standards and Technology" . . . "Ny-Ålesund Svalbard" . . "Australia" . . "time-series measurement" . "USSIMO" . . . "sensor output" . . "Norway" . . "USSIMO spectroradiometer raw data time series" . . "physics" . . "United States of America" . . "light observatory" . . "data" . . "observatory" . . "Teflon" . . "sensor" . . "time series" . . "spectroradiometer" . . "dataset" . . "raw data" . . "Norway" . . "Arctic Zone" . "UiT The Arctic University of Norway" . . "Norwegian University of Science and Technology" . . . "Kings Bay" . "N-NW" . . "NTNU" . . . "UiT The Arctic University" . . "Perth" . "UiT" . . . "56f9c025-4431-44aa-8c4a-c90ceb56df10" . "POINT (11.84213 78.94116)" . . "11.84213" . "78.94116" . "POINT (11.84213 78.94116)" . . "service-account-enrichment" . . . . . . . . . . . . . . . . "13192"^^ . "https://api.rohub.org/api/ros/2eed7eb1-bb6d-4336-b4ec-b832d41270af/crate/download/" . . "2022-03-22 01:31:31.343064+00:00" . "2025-03-05 02:47:05.411745+00:00" . "2022-03-22 01:31:31.343064+00:00" . "UiT The Arctic University of Norway (UiT) and the Norwegian University of Science and Technology (NTNU) established a light observatory at Kings Bay, Ny-Ålesund (Svalbard, Norway) in January 2017. The observatory consists of an array of light sensors including an all sky camera. It is located outside the settlement of Ny-Ålesund, approximately 1 km N-NW of the airport towards Brandalspynten. The array of sensors is mounted on a tripod under a transparent dome. This dataset contains the data of the hyperspectral radiometer USSIMO (In-situ Marine Optics, Perth, WA, Australia). It is equipped with a Zeiss MMS1 UV-VIS NIR detector with National Institute of Standards and Technology, USA traceable radiometric calibration between 380 and 900 nm. This instrument is used for time-series measurement of down-welling spectral irradiance in energy Wm-2 nm-1. Spectral resolution is 10 nm (3.3 nm pixel spacing) and a cosine-corrected polytetrafluoroethylene (PTFE) light diffusor with cosine error: <3% (0 - 60°), <10% (60 - 87.5°), is fitted. The device acquired measurements with a 16 bit analogue to digital converter. It samples continuously internally. Integration time is controlled by the sensor depending on the light intensity, with a maximum of 6 seconds. Actual integration time is stored with the data in each sample. The sensor output is saved on a PC with custom software which records 30 seconds of output data every 29:30 min. Number of samples collected in that period depends on the USSIMO integration time. The sensor is equipped with a pitch and roll sensor which is used to ensure that the spectroradiometer remains in the fixed position throughout the time-series acquisition. This dataset contains the 2019 data." . "application/ld+json" . . . . . "https://w3id.org/ro-id/2eed7eb1-bb6d-4336-b4ec-b832d41270af" . . "USSIMO spectroradiometer raw data time series (2019) measured under the dome of a light observatory in the Arctic (Ny-Ålesund, Svalbard, Norway)" . "MANUAL" . "https://w3id.org/ro-id/2eed7eb1-bb6d-4336-b4ec-b832d41270af/50972f9a-041f-46bd-9d1e-f5c5a55a40db" . . . . . . "Jørgen Berge, Stephen Grant, Rune Bjørgum, Jonathan H. Cohen, David McKee, Geir Johnsen, Artur Zolich, Tomasz Piotr Kopec, Daniel Ludwig Vogedes, and UiT The Arctic University of Norway (UiT). \"USSIMO spectroradiometer raw data time series (2019) measured under the dome of a light observatory in the Arctic (Ny-Ålesund, Svalbard, Norway).\" ROHub. Mar 22 ,2022. https://w3id.org/ro-id/2eed7eb1-bb6d-4336-b4ec-b832d41270af." . "POINT (11.84213 78.94116)" . . . "metadata" . . . "biblio" . . . "raw data" . . . . "data" . . . "Berge, J., Grant, S., Bjørgum, R., Cohen, J. H., McKee, D., Johnsen, G., Zolich, A., Kopec, T. P., Vogedes, D. L., UiT The Arctic University of Norway (2021).USSIMO spectroradiometer raw data time series (2019) measured under the dome of a light observatory in the Arctic (Ny-Ålesund, Svalbard, Norway) [Data set]. Norstore. https://doi.org/10.11582/2021.00045" . "UiT The Arctic University of Norway (UiT)" . "Observation" . . "https://archive.sigma2.no/pages/public/datasetDetail.jsf?id=10.11582/2021.00045" . . "2021-05-19 00:00:00" . "2022-03-22 01:32:34.318806+00:00" . "UiT The Arctic University of Norway (UiT) and the Norwegian University of Science and Technology (NTNU) established a light observatory at Kings Bay, Ny-Ålesund (Svalbard, Norway) in January 2017. The observatory consists of an array of light sensors including an all sky camera. It is located outside the settlement of Ny-Ålesund, approximately 1 km N-NW of the airport towards Brandalspynten. The array of sensors is mounted on a tripod under a transparent dome. This dataset contains the data of the hyperspectral radiometer USSIMO (In-situ Marine Optics, Perth, WA, Australia). It is equipped with a Zeiss MMS1 UV-VIS NIR detector with National Institute of Standards and Technology, USA traceable radiometric calibration between 380 and 900 nm. This instrument is used for time-series measurement of down-welling spectral irradiance in energy Wm-2 nm-1. Spectral resolution is 10 nm (3.3 nm pixel spacing) and a cosine-corrected polytetrafluoroethylene (PTFE) light diffusor with cosine error: <3% (0 - 60°), <10% (60 - 87.5°), is fitted. The device acquired measurements with a 16 bit analogue to digital converter. It samples continuously internally. Integration time is controlled by the sensor depending on the light intensity, with a maximum of 6 seconds. Actual integration time is stored with the data in each sample. The sensor output is saved on a PC with custom software which records 30 seconds of output data every 29:30 min. Number of samples collected in that period depends on the USSIMO integration time. The sensor is equipped with a pitch and roll sensor which is used to ensure that the spectroradiometer remains in the fixed position throughout the time-series acquisition. This dataset contains the 2019 data." . . "USSIMO spectroradiometer raw data time series (2019) measured under the dome of a light observatory in the Arctic (Ny-Ålesund, Svalbard, Norway)" . "2021-05-19 00:00:00" . . . . "Daniel Ludwig Vogedes" . . . . "UiT@rohub.com" . "UiT The Arctic University of Norway (UiT)" . . "artur.zolich@rohub.com" . "Artur Zolich" . . "daniel.ludwig.vogedes@rohub.com" . "Daniel Ludwig Vogedes" . . "david.mckee@rohub.com" . "David McKee" . . "geir.johnsen@rohub.com" . "Geir Johnsen" . . "Geo H." . . "jonathan.h.cohen@rohub.com" . "Jonathan H. Cohen" . . "jorgen.berge@rohub.com" . "Jørgen Berge" . . "rune.bjorgum@rohub.com" . "Rune Bjørgum" . . "stephen.grant@rohub.com" . "Stephen Grant" . . "tomasz.piotr.kopec@rohub.com" . "Tomasz Piotr Kopec" . . . "2026-05-19T13:47:57.245+02:00"^^ . . . . . "USSIMO spectroradiometer raw data time series (2019) measured under the dome of a light observatory in the Arctic (Ny-Ålesund, Svalbard, Norway)" . "RSA" . "MIIBIjANBgkqhkiG9w0BAQEFAAOCAQ8AMIIBCgKCAQEAxszSDYX5tuCSkP7UiCtftYPFNQVTjgNu0I5fwdML2DLRDlp0xzmsQXRk8oHuvwGvG1aMjj6cpUqO+0rz2Sg/wvHOgUpkRH8VJXvmlkhafMLCMtUtk5JIx7e+fkzCby+fnmD7kMkGLrT+OaExWwEDmNlCAt0TPKcHSdwsjso2isXjtAsGevyCMke8ufnFYpjs746JES1eNzVnHnn2Kp/lqcm60GM+J8dLgRZp7fX0anW098xhKym6+xXFzqeju0vYRIHBPerv+r7skWxwk+a7Sd8msqVeYEv6NTqnyWvyWb6Yh8cvj04N6qm/T6C5FUPLQhzSaQgMVMU6yLqjPuu9DwIDAQAB" . "BvFnZdaJ1AFjSh5x5r73t8AjqH0/yksweiEhLSuiJQ84zqBIEvYmTrBnpY5ArV5IQ1fjkwwjSxVAWF8u2EYmkk2EY/dZr2nVKko3AUxLX5cEfU9MJVmRYqytzZOLmRSnkr+hMl6ruM9pbf+bd7ceVujwE5ocP0gN6lB90Hq9h6bAdaHJGfNHf/yHd6p0guFjs+Iz8t5uMZlXf7hfsU6TFd/MdDQhCmFcTvG1x5YK6m8MpqKiE4XedDWjRE1GGkwJchuWN8yrF9bgSrqQb4qcWWz26loK8GsduWvxDQ+23Isr+Ezyw4erm8x8z7rrTzzMWLwqFP/tGIYyTR/H+C864A==" . . . . . . . "" . "Environmental research" . . "" . "Life sciences" . . "" . "Physical sciences" . . "11.84213" . "78.94116" . "POINT (11.84213 78.94116)" . . . "2b40daef-2152-44ad-9a28-a0d37f288bec" . "POINT (11.84213 78.94116)" . . "service-account-enrichment" . . . . . . . . . . . . . . . . "13206"^^ . "https://api.rohub.org/api/ros/e4ed6bdc-327b-4a57-86c0-394bf4a37b3f/crate/download/" . . "2022-03-22 01:32:35.810584+00:00" . "2025-03-05 02:47:05.631433+00:00" . "2022-03-22 01:32:35.810584+00:00" . "UiT The Arctic University of Norway (UiT) and the Norwegian University of Science and Technology (NTNU) established a light observatory at Kings Bay, Ny-Ålesund (Svalbard, Norway) in January 2017. The observatory consists of an array of light sensors including an all sky camera. It is located outside the settlement of Ny-Ålesund, approximately 1 km N-NW of the airport towards Brandalspynten. The array of sensors is mounted on a tripod under a transparent dome. This dataset contains the data of the hyperspectral radiometer USSIMO (In-situ Marine Optics, Perth, WA, Australia). It is equipped with a Zeiss MMS1 UV-VIS NIR detector with National Institute of Standards and Technology, USA traceable radiometric calibration between 380 and 900 nm. This instrument is used for time-series measurement of down-welling spectral irradiance in energy Wm-2 nm-1. Spectral resolution is 10 nm (3.3 nm pixel spacing) and a cosine-corrected polytetrafluoroethylene (PTFE) light diffusor with cosine error: <3% (0 - 60°), <10% (60 - 87.5°), is fitted. The device acquired measurements with a 16 bit analogue to digital converter. It samples continuously internally. Integration time is controlled by the sensor depending on the light intensity, with a maximum of 6 seconds. Actual integration time is stored with the data in each sample. The sensor output is saved on a PC with custom software which records 30 seconds of output data every 29:30 min. Number of samples collected in that period depends on the USSIMO integration time. The sensor is equipped with a pitch and roll sensor which is used to ensure that the spectroradiometer remains in the fixed position throughout the time-series acquisition. This dataset contains the 2020 data." . "application/ld+json" . . . . . "https://w3id.org/ro-id/e4ed6bdc-327b-4a57-86c0-394bf4a37b3f" . . "USSIMO spectroradiometer raw data time series (2020) measured under the dome of a light observatory in the Arctic (Ny-Ålesund, Svalbard, Norway)" . "MANUAL" . "Norway" . "Teflon" . "data" . "dataset" . "observatory" . "raw data" . "sensor" . "spectroradiometer" . "time series" . "earth sciences" . "IT-computer sciences" . "Nanotechnology" . "Software" . "Synthetic and plastic chemicals" . "University" . "Norway" . "data" . "dataset" . "observatory" . "sensor" . "spectroradiometer" . "time series" . "engineering" . "USSIMO spectroradiometer raw data time series" . "UiT The Arctic University" . "light observatory" . "sensor output" . "time-series measurement" . "The observatory consists of an array of light sensors including an all sky camera." . "This dataset contains the data of the hyperspectral radiometer USSIMO In-situ Marine Optics, Perth, WA, Australia) It is equipped with a Zeiss MMS1 UV-VIS NIR detector with National Institute of Standards and Technology, USA traceable radiometric calibration between 380 and 900 nm." . "USSIMO spectroradiometer raw data time series (2020) measured under the dome of a light observatory in the Arctic (Ny-Ålesund, Svalbard, Norway) UiT The Arctic University of Norway (UiT) and the Norwegian University of Science and Technology (NTNU) established a light observatory at Kings Bay, Ny-Ålesund Svalbard, Norway) in January 2017." . "2020" . "30 seconds" . "in Jan-2017" . "of 6 seconds" . "https://w3id.org/ro-id/e4ed6bdc-327b-4a57-86c0-394bf4a37b3f/83569c44-db68-4953-bb10-2a5bb71c2635" . . . . . . "computer science" . "database" . "physics" . "software" . "National Institute of Standards and Technology" . "Arctic Zone" . "Australia" . "Norway" . "Perth" . "Svalbard" . "United States of America" . "Jørgen Berge, Stephen Grant, Rune Bjørgum, Jonathan H. Cohen, David McKee, Geir Johnsen, Artur Zolich, Tomasz Piotr Kopec, Daniel Ludwig Vogedes, and UiT The Arctic University of Norway (UiT). \"USSIMO spectroradiometer raw data time series (2020) measured under the dome of a light observatory in the Arctic (Ny-Ålesund, Svalbard, Norway).\" ROHub. Mar 22 ,2022. https://w3id.org/ro-id/e4ed6bdc-327b-4a57-86c0-394bf4a37b3f." . "POINT (11.84213 78.94116)" . . . "metadata" . . . "raw data" . . . . "data" . . . "biblio" . . . "Berge, J., Grant, S., Bjørgum, R., Cohen, J. H., McKee, D., Johnsen, G., Zolich, A., Kopec, T. P., Vogedes, D. L., UiT The Arctic University of Tromsø (2021).USSIMO spectroradiometer raw data time series (2020) measured under the dome of a light observatory in the Arctic (Ny-Ålesund, Svalbard, Norway) [Data set]. Norstore. https://doi.org/10.11582/2021.00046" . "UiT The Arctic University of Norway (UiT)" . "Observation" . . "https://archive.sigma2.no/pages/public/datasetDetail.jsf?id=10.11582/2021.00046" . . "2021-05-19 00:00:00" . "2022-03-22 01:33:42.099209+00:00" . "UiT The Arctic University of Norway (UiT) and the Norwegian University of Science and Technology (NTNU) established a light observatory at Kings Bay, Ny-Ålesund (Svalbard, Norway) in January 2017. The observatory consists of an array of light sensors including an all sky camera. It is located outside the settlement of Ny-Ålesund, approximately 1 km N-NW of the airport towards Brandalspynten. The array of sensors is mounted on a tripod under a transparent dome. This dataset contains the data of the hyperspectral radiometer USSIMO (In-situ Marine Optics, Perth, WA, Australia). It is equipped with a Zeiss MMS1 UV-VIS NIR detector with National Institute of Standards and Technology, USA traceable radiometric calibration between 380 and 900 nm. This instrument is used for time-series measurement of down-welling spectral irradiance in energy Wm-2 nm-1. Spectral resolution is 10 nm (3.3 nm pixel spacing) and a cosine-corrected polytetrafluoroethylene (PTFE) light diffusor with cosine error: <3% (0 - 60°), <10% (60 - 87.5°), is fitted. The device acquired measurements with a 16 bit analogue to digital converter. It samples continuously internally. Integration time is controlled by the sensor depending on the light intensity, with a maximum of 6 seconds. Actual integration time is stored with the data in each sample. The sensor output is saved on a PC with custom software which records 30 seconds of output data every 29:30 min. Number of samples collected in that period depends on the USSIMO integration time. The sensor is equipped with a pitch and roll sensor which is used to ensure that the spectroradiometer remains in the fixed position throughout the time-series acquisition. This dataset contains the 2020 data." . . "USSIMO spectroradiometer raw data time series (2020) measured under the dome of a light observatory in the Arctic (Ny-Ålesund, Svalbard, Norway)" . "2021-05-19 00:00:00" . . . . "Daniel Ludwig Vogedes" . . . . "UiT@rohub.com" . "UiT The Arctic University of Norway (UiT)" . . "artur.zolich@rohub.com" . "Artur Zolich" . . "daniel.ludwig.vogedes@rohub.com" . "Daniel Ludwig Vogedes" . . "david.mckee@rohub.com" . "David McKee" . . "geir.johnsen@rohub.com" . "Geir Johnsen" . . "Geo H." . . "jonathan.h.cohen@rohub.com" . "Jonathan H. Cohen" . . "jorgen.berge@rohub.com" . "Jørgen Berge" . . "rune.bjorgum@rohub.com" . "Rune Bjørgum" . . "stephen.grant@rohub.com" . "Stephen Grant" . . "tomasz.piotr.kopec@rohub.com" . "Tomasz Piotr Kopec" . . . "2026-05-19T13:47:56.930+02:00"^^ . . . . . "USSIMO spectroradiometer raw data time series (2020) measured under the dome of a light observatory in the Arctic (Ny-Ålesund, Svalbard, Norway)" . "RSA" . "MIIBIjANBgkqhkiG9w0BAQEFAAOCAQ8AMIIBCgKCAQEAxszSDYX5tuCSkP7UiCtftYPFNQVTjgNu0I5fwdML2DLRDlp0xzmsQXRk8oHuvwGvG1aMjj6cpUqO+0rz2Sg/wvHOgUpkRH8VJXvmlkhafMLCMtUtk5JIx7e+fkzCby+fnmD7kMkGLrT+OaExWwEDmNlCAt0TPKcHSdwsjso2isXjtAsGevyCMke8ufnFYpjs746JES1eNzVnHnn2Kp/lqcm60GM+J8dLgRZp7fX0anW098xhKym6+xXFzqeju0vYRIHBPerv+r7skWxwk+a7Sd8msqVeYEv6NTqnyWvyWb6Yh8cvj04N6qm/T6C5FUPLQhzSaQgMVMU6yLqjPuu9DwIDAQAB" . "mZyBw1LbrJewOmRq/2rJMd0PE4r1y1ZANtLLS9V28KlCWTf//oZNF1x6oofCZRKx87kPF1fitiY52founFH8VSXoMkDUo06siSajadFL21hmjERr/NPjDJiVwiG57OJneTImOIHQGqu19B16M269XnfdaQMpQZB+kaWbP1c9LwZFE6BNiKcaWIUwowKA0iPX2lBo0uY5EITLDYlZm1zGDSvWjmOC2MmqdF04+58Y2kr2K0RWfV5a44ufPf+R0qrfuxOL12lN7139qdFjDgn/+AIDkF/ELUkYao3q0xNqfGC/6PjfuQMxbJGnjzgNq9rPuBb+zNbDnFBpEwlnmWOMTQ==" . . . . . . . "" . "Environmental research" . . "" . "Life sciences" . . "" . "Physical sciences" . . "" . "Earth sciences" . . "22.2991" . "80.2951" . "POINT (22.2991 80.2951)" . . . "8a93a745-c942-415f-a9d8-def5bede99b1" . "POINT (22.2991 80.2951)" . . "service-account-enrichment" . . . . . . . . . . . . . . "11405"^^ . "https://api.rohub.org/api/ros/4ff3f101-109b-4e35-babc-46862cd4d330/crate/download/" . . "2022-03-22 01:39:08.957789+00:00" . "2025-03-05 01:24:11.330191+00:00" . "2022-03-22 01:39:08.957789+00:00" . "As part of the \"KROP - Kongsfjorden Rijpfjorden Observatory Programme\" UiT The Arctic University of Norway and The Scottish Association for Marine Science maintain marine observatories (moorings) in two high-Arctic fjords in Svalbard: Kongsfjorden and Rijpfjorden. The observatories consists of an array of CTDs, temperature loggers, ADCPs and a sediment trap, in addition to various other instruments or installations that change from year to year. \nThis dataset contains the CTD, PAR and fluorescence data from Rijpfjorden 2018-2020. \nFluorescence data is given as raw voltage only, due to calibration and fouling issues. It is meant as an indication of the timing of the phytoplankton bloom, not as absolute chlorophyll a concentration. \nNo post-recovery processing of light data (to correct for fouling) has been performed. \nThe observatory layout is available in the mooring diagram provided. \nThe mooring was deployed for 2 years due to heavy ice cover on Rijpfjorden in 2019 which made recovery impossible. It was equipped with 6 SBE37 to get a good picture of the water mass exchange throughout the water column. All sensor still logging after 2 years, the sediment trap only collected the 2018-19 samples." . "application/ld+json" . . . . . "https://w3id.org/ro-id/4ff3f101-109b-4e35-babc-46862cd4d330" . . "Temperature, salinity, light and fluorescence (CTD) measurements from the Rijpfjorden (Svalbard) marine observatory (mooring) August 2018-September 2020" . "MANUAL" . "Svalbard" . "dataset" . "diagram" . "fluorescence" . "information" . "mooring" . "observatory" . "occupational overuse syndrome" . "recovery" . "sediment" . "temperature" . "trap" . "earth sciences" . "CTD" . "Kongsfjorden Rijpfjorden Observatory Programme" . "Rijpfjorden" . "data" . "fluorescence" . "mooring" . "observatory" . "space sciences" . "fluorescence data" . "mooring diagram" . "observatories consist" . "observatory layout" . "sediment trap" . "As part of the \"KROP - Kongsfjorden Rijpfjorden Observatory Programme\" UiT The Arctic University of Norway and The Scottish Association for Marine Science maintain marine observatories (moorings) in two high-Arctic fjords in Svalbard: Kongsfjorden and Rijpfjorden." . "The observatory layout is available in the mooring diagram provided." . "This dataset contains the CTD, PAR and fluorescence data from Rijpfjorden 2018-2020." . "2018-2020" . "Aug-2018-Sep-2020" . "after 2 years" . "for 2 years" . "in 2019 which" . "the 2018-2019" . "https://w3id.org/ro-id/4ff3f101-109b-4e35-babc-46862cd4d330/0bf6a835-85bd-4000-bb1d-2c6077e214bb" . . . . . . "armed forces" . "medicine" . "physics" . "Svalbard" . "Jørgen Berge, Finlo Cottier, Tomasz Piotr Kopec, Estelle Dumont, Emily Joanne Venables, Daniel Ludwig Vogedes, and UiT The Arctic University of Norway (UiT). \"Temperature, salinity, light and fluorescence (CTD) measurements from the Rijpfjorden (Svalbard) marine observatory (mooring) August 2018-September 2020.\" ROHub. Mar 22 ,2022. https://w3id.org/ro-id/4ff3f101-109b-4e35-babc-46862cd4d330." . "POINT (22.2991 80.2951)" . . . "biblio" . . . . "data" . . . "raw data" . . . "metadata" . . . "Berge, J., Cottier, F., Kopec, T. P., Dumont, E., Venables, E. J., Vogedes, D. L., UiT The Arctic University of Norway (2021).Temperature, salinity, light and fluorescence (CTD) measurements from the Rijpfjorden (Svalbard) marine observatory (mooring) August 2018-September 2020 [Data set]. Norstore. https://doi.org/10.11582/2021.00031" . "UiT The Arctic University of Norway (UiT)" . "Observation" . . "https://archive.sigma2.no/pages/public/datasetDetail.jsf?id=10.11582/2021.00031" . . "2021-04-26 00:00:00" . "2022-03-22 01:40:00.650124+00:00" . "As part of the \"KROP - Kongsfjorden Rijpfjorden Observatory Programme\" UiT The Arctic University of Norway and The Scottish Association for Marine Science maintain marine observatories (moorings) in two high-Arctic fjords in Svalbard: Kongsfjorden and Rijpfjorden. The observatories consists of an array of CTDs, temperature loggers, ADCPs and a sediment trap, in addition to various other instruments or installations that change from year to year. \nThis dataset contains the CTD, PAR and fluorescence data from Rijpfjorden 2018-2020. \nFluorescence data is given as raw voltage only, due to calibration and fouling issues. It is meant as an indication of the timing of the phytoplankton bloom, not as absolute chlorophyll a concentration. \nNo post-recovery processing of light data (to correct for fouling) has been performed. \nThe observatory layout is available in the mooring diagram provided. \nThe mooring was deployed for 2 years due to heavy ice cover on Rijpfjorden in 2019 which made recovery impossible. It was equipped with 6 SBE37 to get a good picture of the water mass exchange throughout the water column. All sensor still logging after 2 years, the sediment trap only collected the 2018-19 samples." . . "Temperature, salinity, light and fluorescence (CTD) measurements from the Rijpfjorden (Svalbard) marine observatory (mooring) August 2018-September 2020" . "2021-04-26 00:00:00" . . . . "Daniel Ludwig Vogedes" . . . . "UiT@rohub.com" . "UiT The Arctic University of Norway (UiT)" . . "daniel.ludwig.vogedes@rohub.com" . "Daniel Ludwig Vogedes" . . "emily.joanne.venables@rohub.com" . "Emily Joanne Venables" . . "estelle.dumont@rohub.com" . "Estelle Dumont" . . "finlo.cottier@rohub.com" . "Finlo Cottier" . . "Geo H." . . "jorgen.berge@rohub.com" . "Jørgen Berge" . . "tomasz.piotr.kopec@rohub.com" . "Tomasz Piotr Kopec" . . . "2026-05-19T13:47:56.307+02:00"^^ . . . . . "Temperature, salinity, light and fluorescence (CTD) measurements from the Rijpfjorden (Svalbard) marine observatory (mooring) August 2018-September 2020" . "RSA" . "MIIBIjANBgkqhkiG9w0BAQEFAAOCAQ8AMIIBCgKCAQEAxszSDYX5tuCSkP7UiCtftYPFNQVTjgNu0I5fwdML2DLRDlp0xzmsQXRk8oHuvwGvG1aMjj6cpUqO+0rz2Sg/wvHOgUpkRH8VJXvmlkhafMLCMtUtk5JIx7e+fkzCby+fnmD7kMkGLrT+OaExWwEDmNlCAt0TPKcHSdwsjso2isXjtAsGevyCMke8ufnFYpjs746JES1eNzVnHnn2Kp/lqcm60GM+J8dLgRZp7fX0anW098xhKym6+xXFzqeju0vYRIHBPerv+r7skWxwk+a7Sd8msqVeYEv6NTqnyWvyWb6Yh8cvj04N6qm/T6C5FUPLQhzSaQgMVMU6yLqjPuu9DwIDAQAB" . "ac6wPYQAw1L9cUY5BkDVDJl4UcPCtk4pJPZlK6bwp5b12q0tkTSUT15f/3GT3X8Od9vXC4F658Ut73DUbgJI2gRhZjGheK+r/rMCuf+qM62YtoWxKzaN7XqjEsbrzkgEocio3JnEPBsIIOhu099iWW6U3xIhv7cgIw1q24BJVQRbccyDTM1BMkIWMUhVw2sC2wZH+Wj794cmj5E3BtH8i5BmDM53yJr/YohYyA1LR4aHF9C9G8/iFwBLzRPM7q7t1rs6oxc3bHwv1f72r89UiW+TSq/o7zPmbh95OwS/wkgCRqPe38WVoP2ZsIP0flYmUUZ55XmDH2s8UBEH4IfNdg==" . . . . . . . "" . "Environmental research" . . "" . "Life sciences" . . "" . "Physical sciences" . . "" . "Earth sciences" . . . "5fd6c729-070e-411d-b60c-08a8daa9cce2" . "POINT (22.3038 80.2943)" . . "22.3038" . "80.2943" . "POINT (22.3038 80.2943)" . . "service-account-enrichment" . . . . . . . . . . . . . . "11334"^^ . "https://api.rohub.org/api/ros/65a52384-b1db-4b77-ab42-d61b495ba937/crate/download/" . . "2022-03-22 01:49:03.345354+00:00" . "2025-03-05 01:24:12.299726+00:00" . "2022-03-22 01:49:03.345354+00:00" . "As part of the \"KROP - Kongsfjorden Rijpfjorden Observatory Programme\" UiT The Arctic University of Norway and The Scottish Association for Marine Science maintain marine observatories (moorings) in two high-Arctic fjords in Svalbard: Kongsfjorden and Rijpfjorden. The observatories consists of an array of CTDs, temperature loggers, ADCPs and a sediment trap, in addition to various other instruments or installations that change from year to year. \nThis dataset contains the CTD, PAR and fluorescence data from Rijpfjorden 2014-2015. \nFluorescence data is given as raw voltage only, due to calibration and fouling issues. It is meant as an indication of the timing of the phytoplankton bloom, not as absolute chlorophyll a concentration. \nNo post-recovery processing of light data (to correct for fouling) has been performed. \nTogether with the top and bottom SBE37 two plastic settlement plates had been deployed for a settlement experiment for the recruitment of benthic invertebrates. The sediment trap was mounted at 58m instead the usual depth of 100 m because of specific requirements for an experiment.\nThe observatory layout is available in the mooring diagram provided." . "application/ld+json" . . . . . "https://w3id.org/ro-id/65a52384-b1db-4b77-ab42-d61b495ba937" . . "Temperature, salinity, light and fluorescence (CTD) measurements from the Rijpfjorden (Svalbard) marine observatory (mooring) September 2014-September 2015" . "MANUAL" . "Svalbard" . "dataset" . "diagram" . "fluorescence" . "information" . "layout" . "mooring" . "observatory" . "occupational overuse syndrome" . "sediment" . "temperature" . "trap" . "earth sciences" . "Synthetic and plastic chemicals" . "CTD" . "Kongsfjorden Rijpfjorden Observatory Programme" . "Rijpfjorden" . "data" . "fluorescence" . "mooring" . "observatory" . "space sciences" . "fluorescence data" . "mooring diagram" . "observatories consist" . "observatory layout" . "sediment trap" . "As part of the \"KROP - Kongsfjorden Rijpfjorden Observatory Programme\" UiT The Arctic University of Norway and The Scottish Association for Marine Science maintain marine observatories (moorings) in two high-Arctic fjords in Svalbard: Kongsfjorden and Rijpfjorden." . "The observatory layout is available in the mooring diagram provided." . "This dataset contains the CTD, PAR and fluorescence data from Rijpfjorden 2014-2015." . "2014-2015" . "Sep-2014-Sep-2015" . "https://w3id.org/ro-id/65a52384-b1db-4b77-ab42-d61b495ba937/1280bc3c-1c8e-41f1-be9b-3e605e49280a" . . . . . . "armed forces" . "marine biology" . "medicine" . "physics" . "Svalbard" . "Jørgen Berge, Finlo Cottier, Estelle Dumont, John Beaton, Colin Griffith, Daniel Ludwig Vogedes, and UiT The Arctic University of Norway (UiT). \"Temperature, salinity, light and fluorescence (CTD) measurements from the Rijpfjorden (Svalbard) marine observatory (mooring) September 2014-September 2015.\" ROHub. Mar 22 ,2022. https://w3id.org/ro-id/65a52384-b1db-4b77-ab42-d61b495ba937." . "POINT (22.3038 80.2943)" . . . "raw data" . . . "biblio" . . . "metadata" . . . . "data" . . . "Berge, J., Cottier, F., Dumont, E., Beaton, J., Griffith, C., Vogedes, D. L., UiT The Arctic University of Norway (2021).Temperature, salinity, light and fluorescence (CTD) measurements from the Rijpfjorden (Svalbard) marine observatory (mooring) September 2014-September 2015 [Data set]. Norstore. https://doi.org/10.11582/2021.00018" . "Daniel Ludwig Vogedes" . "Observation" . . "https://archive.sigma2.no/pages/public/datasetDetail.jsf?id=10.11582/2021.00018" . . "2021-03-22 00:00:00" . "2022-03-22 01:49:53.563806+00:00" . "As part of the \"KROP - Kongsfjorden Rijpfjorden Observatory Programme\" UiT The Arctic University of Norway and The Scottish Association for Marine Science maintain marine observatories (moorings) in two high-Arctic fjords in Svalbard: Kongsfjorden and Rijpfjorden. The observatories consists of an array of CTDs, temperature loggers, ADCPs and a sediment trap, in addition to various other instruments or installations that change from year to year. \nThis dataset contains the CTD, PAR and fluorescence data from Rijpfjorden 2014-2015. \nFluorescence data is given as raw voltage only, due to calibration and fouling issues. It is meant as an indication of the timing of the phytoplankton bloom, not as absolute chlorophyll a concentration. \nNo post-recovery processing of light data (to correct for fouling) has been performed. \nTogether with the top and bottom SBE37 two plastic settlement plates had been deployed for a settlement experiment for the recruitment of benthic invertebrates. The sediment trap was mounted at 58m instead the usual depth of 100 m because of specific requirements for an experiment.\nThe observatory layout is available in the mooring diagram provided." . . "Temperature, salinity, light and fluorescence (CTD) measurements from the Rijpfjorden (Svalbard) marine observatory (mooring) September 2014-September 2015" . "2021-03-22 00:00:00" . . . . "Daniel Ludwig Vogedes" . . . . "UiT@rohub.com" . "UiT The Arctic University of Norway (UiT)" . . "colin.griffith@rohub.com" . "Colin Griffith" . . "daniel.ludwig.vogedes@rohub.com" . "Daniel Ludwig Vogedes" . . "estelle.dumont@rohub.com" . "Estelle Dumont" . . "finlo.cottier@rohub.com" . "Finlo Cottier" . . "Geo H." . . "john.beaton@rohub.com" . "John Beaton" . . "jorgen.berge@rohub.com" . "Jørgen Berge" . . . "2026-05-19T13:47:55.162+02:00"^^ . . . . . "Temperature, salinity, light and fluorescence (CTD) measurements from the Rijpfjorden (Svalbard) marine observatory (mooring) September 2014-September 2015" . "RSA" . "MIIBIjANBgkqhkiG9w0BAQEFAAOCAQ8AMIIBCgKCAQEAxszSDYX5tuCSkP7UiCtftYPFNQVTjgNu0I5fwdML2DLRDlp0xzmsQXRk8oHuvwGvG1aMjj6cpUqO+0rz2Sg/wvHOgUpkRH8VJXvmlkhafMLCMtUtk5JIx7e+fkzCby+fnmD7kMkGLrT+OaExWwEDmNlCAt0TPKcHSdwsjso2isXjtAsGevyCMke8ufnFYpjs746JES1eNzVnHnn2Kp/lqcm60GM+J8dLgRZp7fX0anW098xhKym6+xXFzqeju0vYRIHBPerv+r7skWxwk+a7Sd8msqVeYEv6NTqnyWvyWb6Yh8cvj04N6qm/T6C5FUPLQhzSaQgMVMU6yLqjPuu9DwIDAQAB" . "GHlgy4RkSxMcL7HLVWkOziJmqHl6PjuwD403p0sfrs9ox2wgGohnUPtvWxgjvcxUI5OMSE9TQ0H0vCmu2VKm40XKxXqRaoFg/AcemGfDUvMGTosoGtMODumV8Tf0S8mueu4rsZc3XsmF+gUv15l9AOb48SLCn6yAQse/CMvkOjNx080vterbgJJ5Dv3bE0+en12UTPX+T2kZhx7TvU94PEoOmnBI6fcThUZQfE6eC4AfXjAv5Q4hB/HMo9z4Ce4WxMlktoW51sGrEqaXJ0PlsZTWUYyfN5b3LhKibyvxg6QDsB7mUiOG7sg6GUbXvRxYWNKT/QmIPnbwyJ7b6OnqLQ==" . . . . . . . "" . "Environmental research" . . "" . "Life sciences" . . "" . "Physical sciences" . . "" . "Earth sciences" . . "22.29918" . "80.29443" . "POINT (22.29918 80.29443)" . . . "d52a1692-016e-478f-95fc-cc06435a0ee2" . "POINT (22.29918 80.29443)" . . "service-account-enrichment" . . . . . . . . . . . . . . "11088"^^ . "https://api.rohub.org/api/ros/2939a6bb-c42b-4c16-af6a-a56cc065079b/crate/download/" . . "2022-03-22 01:51:43.001070+00:00" . "2025-03-05 01:24:11.147171+00:00" . "2022-03-22 01:51:43.001070+00:00" . "As part of the \"KROP - Kongsfjorden Rijpfjorden Observatory Programme\" UiT The Arctic University of Norway and The Scottish Association for Marine Science maintain marine observatories (moorings) in two high-Arctic fjords in Svalbard: Kongsfjorden and Rijpfjorden. The observatories consists of an array of CTDs, temperature loggers, ADCPs and a sediment trap, in addition to various other instruments or installations that change from year to year. \nThis dataset contains the CTD, PAR and fluorescence data from Rijpfjorden 2017-2018. \nFluorescence data is given as raw voltage only, due to calibration and fouling issues. It is meant as an indication of the timing of the phytoplankton bloom, not as absolute chlorophyll a concentration. \nNo post-recovery processing of light data (to correct for fouling) has been performed. \nThe observatory layout is available in the mooring diagram provided." . "application/ld+json" . . . . . "https://w3id.org/ro-id/2939a6bb-c42b-4c16-af6a-a56cc065079b" . . "Temperature, salinity, light and fluorescence (CTD) measurements from the Rijpfjorden (Svalbard) marine observatory (mooring) August 2017-August 2018" . "MANUAL" . "Svalbard" . "dataset" . "diagram" . "fluorescence" . "information" . "layout" . "mooring" . "observatory" . "occupational overuse syndrome" . "processing" . "recovery" . "temperature" . "earth sciences" . "CTD" . "Kongsfjorden Rijpfjorden Observatory Programme" . "Rijpfjorden" . "data" . "fluorescence" . "mooring" . "observatory" . "space sciences" . "fluorescence data" . "mooring diagram" . "observatories consist" . "observatory layout" . "recovery processing" . "As part of the \"KROP - Kongsfjorden Rijpfjorden Observatory Programme\" UiT The Arctic University of Norway and The Scottish Association for Marine Science maintain marine observatories (moorings) in two high-Arctic fjords in Svalbard: Kongsfjorden and Rijpfjorden." . "The observatory layout is available in the mooring diagram provided." . "This dataset contains the CTD, PAR and fluorescence data from Rijpfjorden 2017-2018." . "2017-2018" . "Aug-2017-Aug-2018" . "https://w3id.org/ro-id/2939a6bb-c42b-4c16-af6a-a56cc065079b/e1bb7d0c-c504-422b-a45e-3dbd5b72448d" . . . . . . "medicine" . "physics" . "Svalbard" . "Jørgen Berge, Finlo Cottier, Tomasz Piotr Kopec, Estelle Dumont, Emily Joanne Venables, Daniel Ludwig Vogedes, and UiT The Arctic University of Norway (UiT). \"Temperature, salinity, light and fluorescence (CTD) measurements from the Rijpfjorden (Svalbard) marine observatory (mooring) August 2017-August 2018.\" ROHub. Mar 22 ,2022. https://w3id.org/ro-id/2939a6bb-c42b-4c16-af6a-a56cc065079b." . "POINT (22.29918 80.29443)" . . . "biblio" . . . "metadata" . . . "raw data" . . . . "data" . . . "Berge, J., Cottier, F., Kopec, T. P., Dumont, E., Venables, E. J., Vogedes, D. L., UiT The Arctic University of Norway (2021).Temperature, salinity, light and fluorescence (CTD) measurements from the Rijpfjorden (Svalbard) marine observatory (mooring) August 2017-August 2018 [Data set]. Norstore. https://doi.org/10.11582/2021.00017" . "UiT The Arctic University of Norway (UiT)" . "Observation" . . "https://archive.sigma2.no/pages/public/datasetDetail.jsf?id=10.11582/2021.00017" . . "2021-03-12 00:00:00" . "2022-03-22 01:52:37.735565+00:00" . "As part of the \"KROP - Kongsfjorden Rijpfjorden Observatory Programme\" UiT The Arctic University of Norway and The Scottish Association for Marine Science maintain marine observatories (moorings) in two high-Arctic fjords in Svalbard: Kongsfjorden and Rijpfjorden. The observatories consists of an array of CTDs, temperature loggers, ADCPs and a sediment trap, in addition to various other instruments or installations that change from year to year. \nThis dataset contains the CTD, PAR and fluorescence data from Rijpfjorden 2017-2018. \nFluorescence data is given as raw voltage only, due to calibration and fouling issues. It is meant as an indication of the timing of the phytoplankton bloom, not as absolute chlorophyll a concentration. \nNo post-recovery processing of light data (to correct for fouling) has been performed. \nThe observatory layout is available in the mooring diagram provided." . . "Temperature, salinity, light and fluorescence (CTD) measurements from the Rijpfjorden (Svalbard) marine observatory (mooring) August 2017-August 2018" . "2021-03-12 00:00:00" . . . . "Daniel Ludwig Vogedes" . . . . "UiT@rohub.com" . "UiT The Arctic University of Norway (UiT)" . . "daniel.ludwig.vogedes@rohub.com" . "Daniel Ludwig Vogedes" . . "emily.joanne.venables@rohub.com" . "Emily Joanne Venables" . . "estelle.dumont@rohub.com" . "Estelle Dumont" . . "finlo.cottier@rohub.com" . "Finlo Cottier" . . "Geo H." . . "jorgen.berge@rohub.com" . "Jørgen Berge" . . "tomasz.piotr.kopec@rohub.com" . "Tomasz Piotr Kopec" . . . "2026-05-19T13:47:54.829+02:00"^^ . . . . . "Temperature, salinity, light and fluorescence (CTD) measurements from the Rijpfjorden (Svalbard) marine observatory (mooring) August 2017-August 2018" . "RSA" . "MIIBIjANBgkqhkiG9w0BAQEFAAOCAQ8AMIIBCgKCAQEAxszSDYX5tuCSkP7UiCtftYPFNQVTjgNu0I5fwdML2DLRDlp0xzmsQXRk8oHuvwGvG1aMjj6cpUqO+0rz2Sg/wvHOgUpkRH8VJXvmlkhafMLCMtUtk5JIx7e+fkzCby+fnmD7kMkGLrT+OaExWwEDmNlCAt0TPKcHSdwsjso2isXjtAsGevyCMke8ufnFYpjs746JES1eNzVnHnn2Kp/lqcm60GM+J8dLgRZp7fX0anW098xhKym6+xXFzqeju0vYRIHBPerv+r7skWxwk+a7Sd8msqVeYEv6NTqnyWvyWb6Yh8cvj04N6qm/T6C5FUPLQhzSaQgMVMU6yLqjPuu9DwIDAQAB" . "pX6k84dn25R2sCdSmB9F3xVCXbbm8HGSQuATrx/iLnS8QGU1zIk90ibqcxmdH+TlGSanEyZfirmMjImW0cu8iidbAYcP1XJOYHXyXVEG/kC7JeaoI2yssqo1zQPa0TBBOhcgl8fh+fPZjw2liZn4e+A+Cm497afSYzAqQm74ecxRD+QlIGnoBb0DJanVzUbC2w97J4uc0tQVwnVKpj+qkRg4YcV31T5UxHpf3qBeI9ezA8f2c6ZYZjefHQOPOKzDB0obDKYj92wENgboxhct2n6cs/VApBl96covQFVx0dNij5me8DYLcR0TnNolQQhpN07QVLDqHkRHXAAz3p30iw==" . . . . . . . "" . "Environmental research" . . "" . "Life sciences" . . "" . "Physical sciences" . . "" . "Earth sciences" . . . "data from Norwegian Meteorological Institute" . . "meteorology" . . "Norway" . . "trends in cold spell" . . "observational data" . . "frequency" . . "analysis" . . "cold weather" . . "dataset" . . "reanalysis data" . . "data from ERA5" . . "Norway" . . "spell" . . "re-analysis" . . "trend" . . "information" . "Norwegian Meteorological Institute" . . "POLYGON ((-20.0 80.0, 40.0 80.0, 40.0 40.0, -20.0 40.0, -20.0 80.0))" . "-20.0 80.0, 40.0 80.0, 40.0 40.0, -20.0 40.0, -20.0 80.0" . . . "b5d7b903-059c-4f00-9347-ffa7082d698d" . "POLYGON ((-20.0 80.0, 40.0 80.0, 40.0 40.0, -20.0 40.0, -20.0 80.0))" . . "service-account-enrichment" . . . . . . . . "7693"^^ . "https://api.rohub.org/api/ros/cb7986b3-a55f-4281-af69-7269917b8a02/crate/download/" . . "2022-03-22 01:52:57.468777+00:00" . "2025-03-05 00:50:49.038103+00:00" . "2022-03-22 01:52:57.468777+00:00" . "This data set contains an analysis of observational data from Norwegian Meteorological Institute and reanalysis data from ERA5." . "application/ld+json" . . . . . "https://w3id.org/ro-id/cb7986b3-a55f-4281-af69-7269917b8a02" . . "Frequency and trends in cold and warm spells in Norway in relation to large-scale atmospheric circulation" . "MANUAL" . "https://w3id.org/ro-id/cb7986b3-a55f-4281-af69-7269917b8a02/f7002b1d-65c6-4458-9cf7-c54a1f7585b9" . . . . . . "Marek Ratajczak. \"Frequency and trends in cold and warm spells in Norway in relation to large-scale atmospheric circulation.\" ROHub. Mar 22 ,2022. https://w3id.org/ro-id/cb7986b3-a55f-4281-af69-7269917b8a02." . "POLYGON ((-20.0 80.0, 40.0 80.0, 40.0 40.0, -20.0 40.0, -20.0 80.0))" . . . "biblio" . . . "metadata" . . . . "data" . . . "raw data" . . . "Ratajczak, M. (2021).Frequency and trends in cold and warm spells in Norway in relation to large-scale atmospheric circulation [Data set]. Norstore. https://doi.org/10.11582/2021.00016" . "Marek Grzegorz Ratajczak" . "Observation" . . "https://archive.sigma2.no/pages/public/datasetDetail.jsf?id=10.11582/2021.00016" . . "2021-03-11 00:00:00" . "2022-03-22 01:53:15.007448+00:00" . "This data set contains an analysis of observational data from Norwegian Meteorological Institute and reanalysis data from ERA5." . . "Frequency and trends in cold and warm spells in Norway in relation to large-scale atmospheric circulation" . "2021-03-11 00:00:00" . . . . "Marek Grzegorz Ratajczak" . . . . "Geo H." . . "marek.ratajczak@rohub.com" . "Marek Ratajczak" . . . "2026-05-19T13:47:54.376+02:00"^^ . . . . . "Frequency and trends in cold and warm spells in Norway in relation to large-scale atmospheric circulation" . "RSA" . "MIIBIjANBgkqhkiG9w0BAQEFAAOCAQ8AMIIBCgKCAQEAxszSDYX5tuCSkP7UiCtftYPFNQVTjgNu0I5fwdML2DLRDlp0xzmsQXRk8oHuvwGvG1aMjj6cpUqO+0rz2Sg/wvHOgUpkRH8VJXvmlkhafMLCMtUtk5JIx7e+fkzCby+fnmD7kMkGLrT+OaExWwEDmNlCAt0TPKcHSdwsjso2isXjtAsGevyCMke8ufnFYpjs746JES1eNzVnHnn2Kp/lqcm60GM+J8dLgRZp7fX0anW098xhKym6+xXFzqeju0vYRIHBPerv+r7skWxwk+a7Sd8msqVeYEv6NTqnyWvyWb6Yh8cvj04N6qm/T6C5FUPLQhzSaQgMVMU6yLqjPuu9DwIDAQAB" . "OazBxXuAxRXffHSskX5MqnpjKP/QqYOHcHR09OLA5c/fh7dYj30sZ2p/ZcMdQCslPqG6DX9HjXVla2Zi+q4Zrd6EkC8iTAkPyRcFsobi+Ie5k7+xK729iQ7lpey8GwrL+XZWD65SSfvwL1kX6XZ2HIzRUg21TcfnjDHgjhnkbkKvOCXUTP8UMCXv7iHy0JJu1dDap5AjDV+AJpR8nucEiMGJK42j+4rmFsMQLm8eCcS/tZTUu2up/3fF0C6+VTHm8NJc/dCtEXao71qrMsJCIRZJ51QhHkrtVWRjPzrwVH7RCKfK+WTKEpjUTMS3WjavUUkKgvBPfQk6zv0MSQKYwg==" . . . . . . . "" . "Environmental research" . . "" . "Life sciences" . . "" . "Physical sciences" . . "" . "Biology" . . "service-account-enrichment" . . . . . . . "7126"^^ . "https://api.rohub.org/api/ros/d6328caa-df3b-4b17-9595-d2e361dfccf1/crate/download/" . . "2022-03-22 01:55:05.007973+00:00" . "2025-03-05 01:19:15.480150+00:00" . "2022-03-22 01:55:05.007973+00:00" . "Custom sequence database from assembled NCBI SRA reads. Supplementary Data to Undheim and Jenner, Nat. Commun., 2021" . "application/ld+json" . . . . . "https://w3id.org/ro-id/d6328caa-df3b-4b17-9595-d2e361dfccf1" . . "SRA transcriptome assemblies" . "MANUAL" . "custom" . "data" . "database" . "national" . "sequence" . "transcriptome" . "earth sciences" . "Genetics" . "IT-computer sciences" . "Newspaper" . "Periodical" . "Commun" . "NCBI SRA" . "Undheim" . "custom" . "data" . "database" . "transcriptome" . "mathematical and computer sciences" . "Nat. Commun" . "SRA transcriptome assembly" . "custom sequence database" . "data to Undheim" . "supplementary data" . "Custom sequence database from assembled NCBI SRA reads." . "SRA transcriptome assemblies." . "Supplementary Data to Undheim and Jenner, Nat. Commun." . . . . . . "database" . "Eivind Undheim. \"SRA transcriptome assemblies.\" ROHub. Mar 22 ,2022. https://w3id.org/ro-id/d6328caa-df3b-4b17-9595-d2e361dfccf1." . . "data" . . . "metadata" . . . "biblio" . . . "raw data" . . . "Undheim, E. (2020).SRA transcriptome assemblies [Data set]. Norstore. https://doi.org/10.11582/2020.00067" . "Eivind Andreas Baste Undheim" . "Observation" . . "https://archive.sigma2.no/pages/public/datasetDetail.jsf?id=10.11582/2020.00067" . . "2020-12-29 00:00:00" . "2022-03-22 01:55:21.374031+00:00" . "Custom sequence database from assembled NCBI SRA reads. Supplementary Data to Undheim and Jenner, Nat. Commun., 2021" . . "SRA transcriptome assemblies" . "2020-12-29 00:00:00" . . . . "Eivind Andreas Baste Undheim" . . . . "eivind.undheim@rohub.com" . "Eivind Undheim" . . "Geo H." . . . "2026-05-19T13:47:53.806+02:00"^^ . . . . . "SRA transcriptome assemblies" . "RSA" . "MIIBIjANBgkqhkiG9w0BAQEFAAOCAQ8AMIIBCgKCAQEAxszSDYX5tuCSkP7UiCtftYPFNQVTjgNu0I5fwdML2DLRDlp0xzmsQXRk8oHuvwGvG1aMjj6cpUqO+0rz2Sg/wvHOgUpkRH8VJXvmlkhafMLCMtUtk5JIx7e+fkzCby+fnmD7kMkGLrT+OaExWwEDmNlCAt0TPKcHSdwsjso2isXjtAsGevyCMke8ufnFYpjs746JES1eNzVnHnn2Kp/lqcm60GM+J8dLgRZp7fX0anW098xhKym6+xXFzqeju0vYRIHBPerv+r7skWxwk+a7Sd8msqVeYEv6NTqnyWvyWb6Yh8cvj04N6qm/T6C5FUPLQhzSaQgMVMU6yLqjPuu9DwIDAQAB" . "CvEN5aXgUvVkJAJ/uOgJupSztURjD3PkZ8v04t73qif8x3tql1CfXgMQ1aos0RClDFvbzqioD5Q4wLu20RZ28n35zUM5ewisemL3yMi7VyCz0c/lRw9Zgh3Grbj8kgPcG5J/tEfiokmtMK0HBcJ8WBc8pkeZoPb/sYuJfGIA9Lq4CIKF53a6kdHa6Loy12kBYGthjkytEX7EDRtaQ91HDpkg3F8ND7BS9KG3+pG8WYQ5i8iYNy/82474hDRwP90lD1N9jHf05p5PEqOVrhHbIYux0d/Ch5QvK3uJlTCdfjjHjGhLMHYaqw9eOXCBtFrk8WVlQBNRDIpdRqK6amsykQ==" . . . . . . . "" . "Environmental research" . . "" . "Life sciences" . . "" . "Physical sciences" . . "" . "Earth sciences" . . . "ground station" . . "report on the gap" . . "fill process" . . "physics" . . "machine learning" . . "soil" . . "short wave" . . "dataset" . . "composition" . . "system" . . "mailto" . . "forest" . . "radiation" . . "stations from GEBA archive" . . "total" . . "information" . . "station" . . "aperture" . . "mailing" . . "machine learning technique" . "UiO" . "trude.storelvmo@geo.uio.no" . "Trude Storelvmo" . . "0000-0002-0068-2430" . "service-account-enrichment" . . . . . . . "7618"^^ . "https://api.rohub.org/api/ros/46f90d7b-1e36-4701-9acd-2681dfe565a6/crate/download/" . . "2022-03-22 01:55:23.106126+00:00" . "2025-03-05 00:59:11.026646+00:00" . "2022-03-22 01:55:23.106126+00:00" . "Global (diffuse and direct) shortwave downwelling radiation at the surface between year 1961 and 2014. A total of 1847 ground stations from GEBA archive has been selected and been through the machine learning technique \"random forests\" (Breiman, 2001) to fill gaps in from original GEBA dataset. A report on the gap filling process can be attained by e-mailing Trude Storelvmo (LINK: mailto:truds@uio.no)." . "application/ld+json" . . . . . "https://w3id.org/ro-id/46f90d7b-1e36-4701-9acd-2681dfe565a6" . . "Gap filled GEBA data" . "MANUAL" . . . . . . "Trude Storelvmo. \"Gap filled GEBA data.\" ROHub. Mar 22 ,2022. https://w3id.org/ro-id/46f90d7b-1e36-4701-9acd-2681dfe565a6." . "biblio" . . . "raw data" . . . "metadata" . . . . "data" . . . "Storelvmo, T. (2020).Gap filled GEBA data [Data set]. Norstore. https://doi.org/10.11582/2020.00066" . "Trude Storelvmo" . "Observation" . . "https://archive.sigma2.no/pages/public/datasetDetail.jsf?id=10.11582/2020.00066" . . "2020-12-21 00:00:00" . "2022-03-22 01:55:40.621748+00:00" . "Global (diffuse and direct) shortwave downwelling radiation at the surface between year 1961 and 2014. A total of 1847 ground stations from GEBA archive has been selected and been through the machine learning technique \"random forests\" (Breiman, 2001) to fill gaps in from original GEBA dataset. A report on the gap filling process can be attained by e-mailing Trude Storelvmo (LINK)." . . "Gap filled GEBA data" . "2020-12-21 00:00:00" . . . . "Trude Storelvmo" . . . . "Geo H." . . . "2026-05-19T13:47:49.328+02:00"^^ . . . . . "Gap filled GEBA data" . "RSA" . "MIIBIjANBgkqhkiG9w0BAQEFAAOCAQ8AMIIBCgKCAQEAxszSDYX5tuCSkP7UiCtftYPFNQVTjgNu0I5fwdML2DLRDlp0xzmsQXRk8oHuvwGvG1aMjj6cpUqO+0rz2Sg/wvHOgUpkRH8VJXvmlkhafMLCMtUtk5JIx7e+fkzCby+fnmD7kMkGLrT+OaExWwEDmNlCAt0TPKcHSdwsjso2isXjtAsGevyCMke8ufnFYpjs746JES1eNzVnHnn2Kp/lqcm60GM+J8dLgRZp7fX0anW098xhKym6+xXFzqeju0vYRIHBPerv+r7skWxwk+a7Sd8msqVeYEv6NTqnyWvyWb6Yh8cvj04N6qm/T6C5FUPLQhzSaQgMVMU6yLqjPuu9DwIDAQAB" . "hP0rkKAHJMFpdIELieVNo3mKIvppBMeQaZJeUkKE1v7nZwYutCedhkUmn0g7ZxWFx+AAVcqxPxJ1ZuuSybuWpsgqKOrk1bIurxNXCYq9La6L1xGITnzmmcrPSX1QWoe+pdJxoMXLEnNfgbRDmDkWorZfRqJo0h1TgA5tMeo+uMIonhQBqOv8/Pei6iS/Tok+NAHWrkD4yJOfDJBRtEW4B+1tY24w0cFZSRhNevgvPhbC/woYBbV7M3ykQAzzC+iMrdCWK+UFubyh7ySwmSCYOZ0lnVbns93o9S5Ah9V9MyU8xaRIF1FnnTZOJtrGPievTBA8dBb5+qxHDWRdOx/yOw==" . . . . . . . "" . "Environmental research" . . "" . "Life sciences" . . "" . "Physical sciences" . . "" . "Biology" . . "15.52992" . "78.26105" . "POINT (15.52992 78.26105)" . . . "dc5618a8-8b14-4ece-a082-c6a3b691c89b" . "POINT (15.52992 78.26105)" . . "service-account-enrichment" . . . . . . . . "8670"^^ . "https://api.rohub.org/api/ros/271b95da-7537-43a1-b65b-a5d84f2227ab/crate/download/" . . "2022-03-22 01:55:42.873140+00:00" . "2025-03-05 01:01:11.472723+00:00" . "2022-03-22 01:55:42.873140+00:00" . "The Isfjorden-Adventfjorden (IsA) time series station is a marine station operated by the University Centre in Svalbard (UNIS). It is located in the mouth of Adventfjorden within Isfjorden on the west coast of Spitsbergen, and is frequently influenced by inflow of warm Atlantic Water from the West Spitsbergen Current. The station is therefore well suited for monitoring seasonal variability and ecosystem effects of climate change. IsA has been sampled on a monthly basis since December 2011. This dataset represents the acid-corrected Chl a values from several depths." . "application/ld+json" . . . . . "https://w3id.org/ro-id/271b95da-7537-43a1-b65b-a5d84f2227ab" . . "ISA_Svalbard_Chlorophyll_A_2011_2019" . "MANUAL" . "Atlantic Ocean" . "Spitsbergen" . "broadcasting station" . "dataset" . "ecosystem" . "effects of climate change" . "inflow" . "station" . "stream mouth" . "time series" . "variability" . "earth sciences" . "Climate change" . "Ecosystem" . "IT-computer sciences" . "Weather" . "Atlantic Ocean" . "ISA_Svalbard_Chlorophyll_A_2011_2019" . "Isfjorden-Adventfjorden" . "University Centre" . "dataset" . "inflow" . "time series" . "geosciences" . "Atlantic water" . "West Spitsbergen Current" . "ecosystem effects of climate change" . "mouth of Adventfjorden" . "time series station" . "IsA has been sampled on a monthly basis since December 2011." . "The Isfjorden-Adventfjorden (IsA) time series station is a marine station operated by the University Centre in Svalbard (UNIS) It is located in the mouth of Adventfjorden within Isfjorden on the west coast of Spitsbergen, and is frequently influenced by inflow of warm Atlantic Water from the West Spitsbergen Current." . "The station is therefore well suited for monitoring seasonal variability and ecosystem effects of climate change." . "since Dec-2011" . "https://w3id.org/ro-id/271b95da-7537-43a1-b65b-a5d84f2227ab/388c2df4-da51-4c59-8696-918f504891a6" . . . . . . "ecology" . "hydrography" . "Atlantic Ocean" . "Spitsbergen" . "Svalbard" . "University Centre in Svalbard (UNIS). \"ISA_Svalbard_Chlorophyll_A_2011_2019.\" ROHub. Mar 22 ,2022. https://w3id.org/ro-id/271b95da-7537-43a1-b65b-a5d84f2227ab." . "POINT (15.52992 78.26105)" . . . . "data" . . . "raw data" . . . "metadata" . . . "biblio" . . . "University Centre in Svalbard (2020).ISA_Svalbard_Chlorophyll_A_2011_2019 [Data set]. Norstore. https://doi.org/10.11582/2020.00063" . "University Centre in Svalbard (UNIS)" . "Observation" . . "https://archive.sigma2.no/pages/public/datasetDetail.jsf?id=10.11582/2020.00063" . . "2020-12-09 00:00:00" . "2022-03-22 01:56:01.214326+00:00" . "The Isfjorden-Adventfjorden (IsA) time series station is a marine station operated by the University Centre in Svalbard (UNIS). It is located in the mouth of Adventfjorden within Isfjorden on the west coast of Spitsbergen, and is frequently influenced by inflow of warm Atlantic Water from the West Spitsbergen Current. The station is therefore well suited for monitoring seasonal variability and ecosystem effects of climate change. IsA has been sampled on a monthly basis since December 2011. This dataset represents the acid-corrected Chl a values from several depths." . . "ISA_Svalbard_Chlorophyll_A_2011_2019" . "2020-12-09 00:00:00" . . . . "Luke Marsden" . . . . "UNIS@rohub.com" . "University Centre in Svalbard (UNIS)" . . "Geo H." . . . "2026-05-19T13:47:49.046+02:00"^^ . . . . . "ISA_Svalbard_Chlorophyll_A_2011_2019" . "RSA" . "MIIBIjANBgkqhkiG9w0BAQEFAAOCAQ8AMIIBCgKCAQEAxszSDYX5tuCSkP7UiCtftYPFNQVTjgNu0I5fwdML2DLRDlp0xzmsQXRk8oHuvwGvG1aMjj6cpUqO+0rz2Sg/wvHOgUpkRH8VJXvmlkhafMLCMtUtk5JIx7e+fkzCby+fnmD7kMkGLrT+OaExWwEDmNlCAt0TPKcHSdwsjso2isXjtAsGevyCMke8ufnFYpjs746JES1eNzVnHnn2Kp/lqcm60GM+J8dLgRZp7fX0anW098xhKym6+xXFzqeju0vYRIHBPerv+r7skWxwk+a7Sd8msqVeYEv6NTqnyWvyWb6Yh8cvj04N6qm/T6C5FUPLQhzSaQgMVMU6yLqjPuu9DwIDAQAB" . "EMWIBIjFpB6CxSqkzGlmjMEG+oLtF/ZjoAp5f90RdNUEY2aYtzZ6Lfm8gk+s/ogc5CBgF4jitQAABp7JyCvQiVAcMoAvAQ7jWFg3jUmpwWoZfUX+DEp10/vh3dugOGeXrS6F3Iygza0lHm1ZvR0R+YqnydmKwKA0kJnBYYNd7KHzpEnPgzCIp/KNoILO/xMhY7SvSnRdPi//+AFwwXZnZ8kuXsFZTq15fOGB6tCejTETwGXtaAH8u/9CAJYQac3ryXvC38KWSBNM7s84sU+brW1BX6sHpdlCCkyFkFMkND43KgkkfYNr+uPha5uICF+rxI/EoH0CxSsMYKuREdvq7g==" . . . . . . . "" . "Environmental research" . . "" . "Life sciences" . . "" . "Physical sciences" . . "" . "Chemistry" . . "force field" . . "23.076923076923077" . "9.9" . "biochemistry" . . "58.82352941176471" . "6.0" . "file" . . "13.51981351981352" . "5.8" . "results file" . . "13.58428805237316" . "8.3" . "Organic chemical" . . "Economy, business and finance/Economic sector/Chemicals/Organic chemical" . "betterment" . . "11.616766467065867" . "9.7" . "Physics" . . "Science and technology/Natural science/Physics" . "raw data" . . "7.18562874251497" . "6.0" . "chemistry and materials (general)" . . "100.0" . "0.38146594166755676" . "validation" . . "10.955710955710956" . "4.7" . "force field" . . "16.047904191616766" . "13.4" . "Newspaper" . . "Arts, culture and entertainment/Mass media/Newspaper" . "Results are divided in QM calculations+force field comparison and improvements, and force field parameter validations." . . "37.755102040816325" . "14.8" . "Results for Tyrosine-choline, Phenylalanine-choline and Tryptophan-choline force field improvements." . . "28.061224489795915" . "11.0" . "improvement" . . "16.083916083916083" . "6.9" . "earth sciences" . . "100.0" . "0.620610237121582" . "result" . . "6.107784431137724" . "5.1" . "manuscripts file" . . "8.67430441898527" . "5.3" . "comparison" . . "4.6706586826347305" . "3.9" . "quartermaster" . . "8.622754491017965" . "7.2" . "chemistry and materials" . . "100.0" . "0.38146594166755676" . "force field comparison" . . "20.29459901800327" . "12.4" . "QM calculation" . . "12.76595744680851" . "7.8" . "computer science" . . "18.627450980392158" . "1.9" . "service-account-enrichment" . . . . . . . "9478"^^ . "https://api.rohub.org/api/ros/b7df46c2-d54e-4cf0-8600-36516706cfbe/crate/download/" . . "2022-03-22 02:18:37.698329+00:00" . "2025-03-05 00:45:29.658387+00:00" . "2022-03-22 02:18:37.698329+00:00" . "Results for Tyrosine-choline, Phenylalanine-choline and Tryptophan-choline force field improvements. For ease of processing, results from both works are kept together. Results are divided in QM calculations+force field comparison and improvements, and force field parameter validations.\n\nIf you have trouble navigating, please send email to LINK: mailto:reza.611@gmail.com.\n\n\n### Please see the file \"file_organisations\" for the directories and subdirectories.\n\n# Results files are organised based on QM calculations and force field comparisons (also improvements), and Parameters validations where you have the test cases. For the QM calculations, they are based on the softwares and methods used. PSI4 directories for energy decompositions and SAPT methods, further divided in subdiectories. NWCHEM is for all other QM methods, and those can be differentiated by the dircetoty names which contains the method (DFT, MP2, CCSD(T)) and basis sets. CHARMM* directories contains the force field comparison vs the improvements test.\n\nThe Khan_etal_JCTC_2016 paper contains phenol-TMA and benzene-TMA cases. The Khan_etal_JCTC_2019 contains the indole-TMA case.\n\nFor the QM part, benzene-tma and indole-tma directories have naming explicitly (i.e. NWCHEM_cat_pi_benzene_tma/, PSI4_calc_benzene_tma/, CHARMM_pes_cat_pi_benzene_tma/). For phenol-TMA, look at the *_RESTART directories; these are the production ones for CHARMM and NWCHEM cases. For PSI4, it is PSI4_calc/). Other directories are old tests with different PES conditions (relaxation etc.). I did not remove them for my personal reference.\n\n# For the Parameters validations, reboot_piplc-dmpc/ is the test case for Khan_etal_JCTC_2016; all others are for Khan_etal_JCTC_2019.\n\n### Manuscripts files are seperated for both these works in the main directories with submission files and figures. The raw data are also there. You will also find the raw data in the different results subdirectories.\n\n*** I am writing this very quickly, so some explanations might not be obvious. If you have doubt, please send email to LINK: mailto:reza.611@gmail.com." . "application/ld+json" . . . . . "https://w3id.org/ro-id/b7df46c2-d54e-4cf0-8600-36516706cfbe" . . "2016_Khan_etal_JCTC" . "MANUAL" . . . . . . "https://w3id.org/ro-id/0d57f62d-6c70-40b8-9d8e-e9a566cad649" . "https://w3id.org/ro-id/ae6ff238-5828-468f-96fb-4ccf675ca305" . "https://w3id.org/ro-id/f026d752-ef4f-4eb3-bd58-204c343a38a3" . "https://w3id.org/ro-id/15b367a2-7f08-4111-9f25-e305fe38a0d4" . "https://w3id.org/ro-id/4a19e75c-d6a3-4d35-b5a2-983f9386e7df" . "https://w3id.org/ro-id/6a5072ec-d759-43ed-bffe-54269bbaec0a" . "https://w3id.org/ro-id/76b25a83-0ac2-47af-ba30-a57d580444ac" . "https://w3id.org/ro-id/7be25221-aa5c-4111-baae-72c2b0a9ea3d" . "https://w3id.org/ro-id/83227a6c-fc8b-4c33-8e0a-e22a7ecbd466" . "https://w3id.org/ro-id/c93a421e-e398-46dc-b619-e8c2c2d6b754" . "https://w3id.org/ro-id/cec39022-070a-4186-9a3b-f4afb95e4e04" . "https://w3id.org/ro-id/d00a2fea-2639-4214-8e89-e7e029ee4cc3" . "https://w3id.org/ro-id/dfa0f404-0ce4-42e0-9f20-f0a49017bab8" . "https://w3id.org/ro-id/e5db7894-f353-4242-bd8e-1b9193d7da4e" . "https://w3id.org/ro-id/ef77f5d5-6dbb-49f0-a362-52fd884161bd" . "https://w3id.org/ro-id/76682de5-ba8d-4121-a995-42edee55b9ea" . "https://w3id.org/ro-id/c8330e75-3669-4710-8eae-233dff9ed7db" . "https://w3id.org/ro-id/10c24aae-d46c-48e3-8a62-130cba301ea2" . "https://w3id.org/ro-id/3d2a408d-b8b1-49b5-9eee-2384a5b9c45c" . "https://w3id.org/ro-id/6ada0939-f2a7-48e3-bf28-ded4054d05c5" . "https://w3id.org/ro-id/fe92320b-d092-4d17-9002-09f6a1cafac6" . "https://w3id.org/ro-id/fef725a8-2d68-4745-868b-5f8276d364b5" . "https://w3id.org/ro-id/0af7beec-53cf-4022-b048-2843ecf01aa4" . "https://w3id.org/ro-id/0e4e9ab8-d4e9-41ef-b6a1-655dd17d5415" . "https://w3id.org/ro-id/69eca4e5-31ca-47e2-b7ed-19e4a5d3f053" . "https://w3id.org/ro-id/75647177-6b16-4ebf-a946-48ff3b600413" . "https://w3id.org/ro-id/ee1bbe17-772c-46bb-b304-baade63555a8" . "https://w3id.org/ro-id/f534d7b0-e5e1-4f73-adeb-7478f274586a" . "https://w3id.org/ro-id/fd42eafd-774b-4be5-81db-1fa4019a03e8" . "https://w3id.org/ro-id/677261f6-b685-4b94-99ef-4cd89dfa629b" . "https://w3id.org/ro-id/83f81bde-e952-47fc-9794-d26d6d19d31f" . "https://w3id.org/ro-id/10343264-da33-4b51-98dd-78bb264b85e4" . "https://w3id.org/ro-id/7a1ad00d-5694-444f-9d82-88ac60ea68f7" . "https://w3id.org/ro-id/8a35b2bf-6a3d-4f32-bded-47ebd8d39999" . "https://w3id.org/ro-id/9c4bb3c1-8f1a-4bd0-a8b7-474606e4312a" . "https://w3id.org/ro-id/c61ae304-ecf9-4e49-b012-0db5e0453981" . "https://w3id.org/ro-id/fe12d1bc-0348-4616-b250-9382962a23bc" . "https://w3id.org/ro-id/6c07622b-9d77-48b3-a892-f24e34ef7c57" . "https://w3id.org/ro-id/6f457be9-fb82-4597-80a3-bf0c1a8faa75" . "https://w3id.org/ro-id/f43a3122-c71d-487c-bf34-0aea1c6a60d1" . "Nathalie Reuter. \"2016_Khan_etal_JCTC.\" ROHub. Mar 22 ,2022. https://w3id.org/ro-id/b7df46c2-d54e-4cf0-8600-36516706cfbe." . . "biblio" . . . . "data" . . . "metadata" . . . "raw data" . . . "Reuter, N. (2021).2016_Khan_etal_JCTC [Data set]. Norstore. https://doi.org/10.11582/2021.00103" . "Nathalie Reuter" . "Simulation" . . "https://archive.sigma2.no/pages/public/datasetDetail.jsf?id=10.11582/2021.00103" . . "2021-11-22 00:00:00" . "2022-03-22 02:18:56.113155+00:00" . "Results for Tyrosine-choline, Phenylalanine-choline and Tryptophan-choline force field improvements. For ease of processing, results from both works are kept together. Results are divided in QM calculations+force field comparison and improvements, and force field parameter validations.\n\nIf you have trouble navigating, please send email to LINK.\n\n\n### Please see the file \"file_organisations\" for the directories and subdirectories.\n\n# Results files are organised based on QM calculations and force field comparisons (also improvements), and Parameters validations where you have the test cases. For the QM calculations, they are based on the softwares and methods used. PSI4 directories for energy decompositions and SAPT methods, further divided in subdiectories. NWCHEM is for all other QM methods, and those can be differentiated by the dircetoty names which contains the method (DFT, MP2, CCSD(T)) and basis sets. CHARMM* directories contains the force field comparison vs the improvements test.\n\nThe Khan_etal_JCTC_2016 paper contains phenol-TMA and benzene-TMA cases. The Khan_etal_JCTC_2019 contains the indole-TMA case.\n\nFor the QM part, benzene-tma and indole-tma directories have naming explicitly (i.e. NWCHEM_cat_pi_benzene_tma/, PSI4_calc_benzene_tma/, CHARMM_pes_cat_pi_benzene_tma/). For phenol-TMA, look at the *_RESTART directories; these are the production ones for CHARMM and NWCHEM cases. For PSI4, it is PSI4_calc/). Other directories are old tests with different PES conditions (relaxation etc.). I did not remove them for my personal reference.\n\n# For the Parameters validations, reboot_piplc-dmpc/ is the test case for Khan_etal_JCTC_2016; all others are for Khan_etal_JCTC_2019.\n\n### Manuscripts files are seperated for both these works in the main directories with submission files and figures. The raw data are also there. You will also find the raw data in the different results subdirectories.\n\n*** I am writing this very quickly, so some explanations might not be obvious. If you have doubt, please send email to LINK." . . "2016_Khan_etal_JCTC" . "2021-11-22 00:00:00" . . . . "Nathalie Reuter" . . "https://doi.org/10.1021/acs.jctc.6b00654" . . "2022-03-22 02:18:51.634853+00:00" . "2022-03-22 02:18:51.891040+00:00" . . "https://doi.org/10.1021/acs.jctc.6b00654" . "2022-03-22 02:18:51.634853+00:00" . . . . . . . "force field parameter validation" . . "14.238952536824875" . "8.7" . "geology" . . "100.0" . "0.620610237121582" . "subdirectory" . . "5.389221556886228" . "4.5" . "choline" . . "8.502994011976048" . "7.1" . "file" . . "9.461077844311378" . "7.9" . "directory" . . "8.74251497005988" . "7.3" . "validation" . . "7.664670658682635" . "6.4" . "directory" . . "12.121212121212121" . "5.2" . "calculation" . . "5.9880239520958085" . "5.0" . "armed forces" . . "22.549019607843135" . "2.3" . "# Results files are organised based on QM calculations and force field comparisons (also improvements), and Parameters validations where you have the test cases." . . "34.183673469387756" . "13.4" . "choline" . . "12.121212121212121" . "5.2" . "QM" . . "12.121212121212121" . "5.2" . "tryptophan-choline force field improvement" . . "30.441898527004913" . "18.6" . "IT-computer sciences" . . "Science and technology/Technology and engineering/IT-computer sciences" . "Diseases and conditions" . . "Health/Diseases and conditions" . "Geo H." . . "nathalie.reuter@rohub.com" . "Nathalie Reuter" . . . "2026-05-19T13:47:45.367+02:00"^^ . . . . . "2016_Khan_etal_JCTC" . "RSA" . "MIIBIjANBgkqhkiG9w0BAQEFAAOCAQ8AMIIBCgKCAQEAxszSDYX5tuCSkP7UiCtftYPFNQVTjgNu0I5fwdML2DLRDlp0xzmsQXRk8oHuvwGvG1aMjj6cpUqO+0rz2Sg/wvHOgUpkRH8VJXvmlkhafMLCMtUtk5JIx7e+fkzCby+fnmD7kMkGLrT+OaExWwEDmNlCAt0TPKcHSdwsjso2isXjtAsGevyCMke8ufnFYpjs746JES1eNzVnHnn2Kp/lqcm60GM+J8dLgRZp7fX0anW098xhKym6+xXFzqeju0vYRIHBPerv+r7skWxwk+a7Sd8msqVeYEv6NTqnyWvyWb6Yh8cvj04N6qm/T6C5FUPLQhzSaQgMVMU6yLqjPuu9DwIDAQAB" . "J6DsmJ62stzlmEy4hRvQ8S9M2SToMiyDphwOnYUWXDxuYZgv7YeHzlvNwjo6GlaT4V9WKo45gZapePs3+QOydGQboxT6UW0ImTuL8WSaF2WyGzv2k7qO/xLqk7JV6tyzQGeCGQeeapUBjTdihgsgf0gfQKq7s40u3435njh/o/IS+AYR1ekaZ+gOStwOmAz/XQzxPJznm2bLbNmZawIBQIkjvPCSwwOV9xIZhkfoZiPVB98fZKK43lvb5bT+YbYfg0blr2oNcUop3wG59XDz4vtkYinG9U85aAZuC8cAdjH1H/0ujgYaiEfqmxDgmtXYMPqoqDL3vuVXUDpvKNYOnw==" . . . . . . . "" . "Environmental research" . . "" . "Life sciences" . . "" . "Physical sciences" . . "" . "Chemistry" . . "Physics" . . "Science and technology/Natural science/Physics" . "tryptophan-choline force field improvement" . . "30.441898527004913" . "18.6" . "manuscripts file" . . "8.67430441898527" . "5.3" . "subdirectory" . . "5.389221556886228" . "4.5" . "quartermaster" . . "8.622754491017965" . "7.2" . "biochemistry" . . "58.82352941176471" . "6.0" . "improvement" . . "16.083916083916083" . "6.9" . "betterment" . . "11.616766467065867" . "9.7" . "Organic chemical" . . "Economy, business and finance/Economic sector/Chemicals/Organic chemical" . "comparison" . . "4.6706586826347305" . "3.9" . "earth sciences" . . "100.0" . "0.620610237121582" . "force field" . . "23.076923076923077" . "9.9" . "validation" . . "7.664670658682635" . "6.4" . "Diseases and conditions" . . "Health/Diseases and conditions" . "armed forces" . . "22.549019607843135" . "2.3" . "force field" . . "16.047904191616766" . "13.4" . "geology" . . "100.0" . "0.620610237121582" . "force field parameter validation" . . "14.238952536824875" . "8.7" . "calculation" . . "5.9880239520958085" . "5.0" . "service-account-enrichment" . . . . . . . "9458"^^ . "https://api.rohub.org/api/ros/6d7f7856-f2c8-4172-9a35-ef22b6cc4561/crate/download/" . . "2022-03-22 02:18:57.862656+00:00" . "2025-03-05 00:45:31.255755+00:00" . "2022-03-22 02:18:57.862656+00:00" . "Results for Tyrosine-choline, Phenylalanine-choline and Tryptophan-choline force field improvements. For ease of processing, results from both works are kept together. Results are divided in QM calculations+force field comparison and improvements, and force field parameter validations.\n\nIf you have trouble navigating, please send email to LINK: mailto:reza.611@gmail.com.\n\n\n### Please see the file \"file_organisations\" for the directories and subdirectories.\n\n# Results files are organised based on QM calculations and force field comparisons (also improvements), and Parameters validations where you have the test cases. For the QM calculations, they are based on the softwares and methods used. PSI4 directories for energy decompositions and SAPT methods, further divided in subdiectories. NWCHEM is for all other QM methods, and those can be differentiated by the dircetoty names which contains the method (DFT, MP2, CCSD(T)) and basis sets. CHARMM* directories contains the force field comparison vs the improvements test.\n\nThe Khan_etal_JCTC_2016 paper contains phenol-TMA and benzene-TMA cases. The Khan_etal_JCTC_2019 contains the indole-TMA case.\n\nFor the QM part, benzene-tma and indole-tma directories have naming explicitly (i.e. NWCHEM_cat_pi_benzene_tma/, PSI4_calc_benzene_tma/, CHARMM_pes_cat_pi_benzene_tma/). For phenol-TMA, look at the *_RESTART directories; these are the production ones for CHARMM and NWCHEM cases. For PSI4, it is PSI4_calc/). Other directories are old tests with different PES conditions (relaxation etc.). I did not remove them for my personal reference.\n\n# For the Parameters validations, reboot_piplc-dmpc/ is the test case for Khan_etal_JCTC_2016; all others are for Khan_etal_JCTC_2019.\n\n### Manuscripts files are seperated for both these works in the main directories with submission files and figures. The raw data are also there. You will also find the raw data in the different results subdirectories.\n\n*** I am writing this very quickly, so some explanations might not be obvious. If you have doubt, please send email to LINK: mailto:reza.611@gmail.com." . "application/ld+json" . . . . . "https://w3id.org/ro-id/6d7f7856-f2c8-4172-9a35-ef22b6cc4561" . . "2019_Khan_etal_JCTC" . "MANUAL" . . . . . . "https://w3id.org/ro-id/1eb8b1da-9a9a-4f3d-85dd-f7806d7716ac" . "https://w3id.org/ro-id/45c97f98-4cfc-4aec-a86d-972e5ee7c719" . "https://w3id.org/ro-id/f94049ca-f965-407c-bbd6-9dec6d0b4f36" . "https://w3id.org/ro-id/1b8dc5b9-3af9-4db4-91b7-47e4762481cf" . "https://w3id.org/ro-id/1e7f2235-59f3-486d-9c05-8208bc9b6650" . "https://w3id.org/ro-id/2497f9a5-a789-4c12-87f7-36adaafe0b2f" . "https://w3id.org/ro-id/38d6400b-ef9c-491a-87db-aa0e19241052" . "https://w3id.org/ro-id/42da6fae-3c5d-402f-a475-e3de433fb9c5" . "https://w3id.org/ro-id/51678519-ffd4-4990-a2ef-45e8cebea870" . "https://w3id.org/ro-id/6d49e53b-ee7d-487c-8005-f3d33075c010" . "https://w3id.org/ro-id/9d724b70-f51e-4801-a33c-0ddacb9f6380" . "https://w3id.org/ro-id/a373b5e2-9377-4ea5-ac77-3000d7e4ea1d" . "https://w3id.org/ro-id/b4696554-3ad0-482c-a812-64ad881bf2df" . "https://w3id.org/ro-id/bd4b37ee-9510-4d1b-a866-d5ac716d7d6d" . "https://w3id.org/ro-id/f1de38ae-6531-4b97-b7cb-871e09afdb6c" . "https://w3id.org/ro-id/3b59da1c-05ba-4240-9d9c-5fb7b28ad53c" . "https://w3id.org/ro-id/5a3f3091-042f-4b19-9448-202c9bc06e4a" . "https://w3id.org/ro-id/02142eed-e7ad-4ecf-b92c-17535047e45e" . "https://w3id.org/ro-id/2a817a60-bda4-4de6-811b-8b464c6f4fbe" . "https://w3id.org/ro-id/43eecec7-f276-4fa6-a009-b6d74bee5ac4" . "https://w3id.org/ro-id/8fe39cdd-2592-442a-ab2f-75bce594e8bc" . "https://w3id.org/ro-id/ebb04bc3-1b64-4723-abb1-2bb1e9fb5c41" . "https://w3id.org/ro-id/1fd4a1b7-7f08-4932-81b9-e3e8219a45bd" . "https://w3id.org/ro-id/42c9b12d-dec9-4e1d-bfa3-e6b20ca574ed" . "https://w3id.org/ro-id/77b8f708-1da5-4937-88c1-bf913536e396" . "https://w3id.org/ro-id/780df816-5a29-4a1e-ada6-975c80157441" . "https://w3id.org/ro-id/91a19a15-66ea-4795-b53f-18d843c39303" . "https://w3id.org/ro-id/dfcc6de7-f307-4a3d-b80f-1ea59b685cea" . "https://w3id.org/ro-id/e68dd0da-25b0-4f21-83a8-2090c91f2290" . "https://w3id.org/ro-id/931b0404-6d29-470f-bb13-ac082723d322" . "https://w3id.org/ro-id/dbfc01ff-6296-4efc-bf3a-072f7c2409b6" . "https://w3id.org/ro-id/08b34e3d-b475-4ece-a0e7-0a6e52e6453e" . "https://w3id.org/ro-id/1a33ec44-1314-4e9b-b0f4-9476e11d0c7b" . "https://w3id.org/ro-id/6510d15b-80ba-43f6-bd4e-bd8cb28ff442" . "https://w3id.org/ro-id/822a91de-8ad6-49aa-821a-fed4a5f225a0" . "https://w3id.org/ro-id/c9e71228-0405-4c6b-9183-c94103544c47" . "https://w3id.org/ro-id/e13cc288-ae77-4cc5-9a27-2223c47c4bd9" . "https://w3id.org/ro-id/b2bb9f47-e1bf-472d-b70d-b04bbbb8cdd1" . "https://w3id.org/ro-id/c15316b5-7fc7-4545-a8bb-f8d31e4060d6" . "https://w3id.org/ro-id/fe8868e4-2180-433d-b349-a8b9f0a2692c" . "Nathalie Reuter. \"2019_Khan_etal_JCTC.\" ROHub. Mar 22 ,2022. https://w3id.org/ro-id/6d7f7856-f2c8-4172-9a35-ef22b6cc4561." . "metadata" . . . "raw data" . . . . "data" . . . . "biblio" . . . . "https://doi.org/10.1021/acs.jctc.8b00839" . . "2022-03-22 02:19:11.787124+00:00" . "2022-03-22 02:19:12.026713+00:00" . . "https://doi.org/10.1021/acs.jctc.8b00839" . "2022-03-22 02:19:11.787124+00:00" . . . . "Reuter, N. (2021).2019_Khan_etal_JCTC [Data set]. Norstore. https://doi.org/10.11582/2021.00104" . "Nathalie Reuter" . "Simulation" . . "https://archive.sigma2.no/pages/public/datasetDetail.jsf?id=10.11582/2021.00104" . . "2021-11-22 00:00:00" . "2022-03-22 02:19:16.071315+00:00" . "Results for Tyrosine-choline, Phenylalanine-choline and Tryptophan-choline force field improvements. For ease of processing, results from both works are kept together. Results are divided in QM calculations+force field comparison and improvements, and force field parameter validations.\n\nIf you have trouble navigating, please send email to LINK.\n\n\n### Please see the file \"file_organisations\" for the directories and subdirectories.\n\n# Results files are organised based on QM calculations and force field comparisons (also improvements), and Parameters validations where you have the test cases. For the QM calculations, they are based on the softwares and methods used. PSI4 directories for energy decompositions and SAPT methods, further divided in subdiectories. NWCHEM is for all other QM methods, and those can be differentiated by the dircetoty names which contains the method (DFT, MP2, CCSD(T)) and basis sets. CHARMM* directories contains the force field comparison vs the improvements test.\n\nThe Khan_etal_JCTC_2016 paper contains phenol-TMA and benzene-TMA cases. The Khan_etal_JCTC_2019 contains the indole-TMA case.\n\nFor the QM part, benzene-tma and indole-tma directories have naming explicitly (i.e. NWCHEM_cat_pi_benzene_tma/, PSI4_calc_benzene_tma/, CHARMM_pes_cat_pi_benzene_tma/). For phenol-TMA, look at the *_RESTART directories; these are the production ones for CHARMM and NWCHEM cases. For PSI4, it is PSI4_calc/). Other directories are old tests with different PES conditions (relaxation etc.). I did not remove them for my personal reference.\n\n# For the Parameters validations, reboot_piplc-dmpc/ is the test case for Khan_etal_JCTC_2016; all others are for Khan_etal_JCTC_2019.\n\n### Manuscripts files are seperated for both these works in the main directories with submission files and figures. The raw data are also there. You will also find the raw data in the different results subdirectories.\n\n*** I am writing this very quickly, so some explanations might not be obvious. If you have doubt, please send email to LINK." . . "2019_Khan_etal_JCTC" . "2021-11-22 00:00:00" . . . . "Nathalie Reuter" . . . . "directory" . . "12.121212121212121" . "5.2" . "QM" . . "12.121212121212121" . "5.2" . "force field comparison" . . "20.29459901800327" . "12.4" . "IT-computer sciences" . . "Science and technology/Technology and engineering/IT-computer sciences" . "choline" . . "12.121212121212121" . "5.2" . "chemistry and materials (general)" . . "100.0" . "0.38146594166755676" . "result" . . "6.107784431137724" . "5.1" . "raw data" . . "7.18562874251497" . "6.0" . "Results are divided in QM calculations+force field comparison and improvements, and force field parameter validations." . . "37.755102040816325" . "14.8" . "choline" . . "8.502994011976048" . "7.1" . "directory" . . "8.74251497005988" . "7.3" . "# Results files are organised based on QM calculations and force field comparisons (also improvements), and Parameters validations where you have the test cases." . . "34.183673469387756" . "13.4" . "QM calculation" . . "12.76595744680851" . "7.8" . "chemistry and materials" . . "100.0" . "0.38146594166755676" . "validation" . . "10.955710955710956" . "4.7" . "results file" . . "13.58428805237316" . "8.3" . "file" . . "13.51981351981352" . "5.8" . "Newspaper" . . "Arts, culture and entertainment/Mass media/Newspaper" . "file" . . "9.461077844311378" . "7.9" . "computer science" . . "18.627450980392158" . "1.9" . "Results for Tyrosine-choline, Phenylalanine-choline and Tryptophan-choline force field improvements." . . "28.061224489795915" . "11.0" . "Geo H." . . "nathalie.reuter@rohub.com" . "Nathalie Reuter" . . . "2026-05-19T13:47:45.024+02:00"^^ . . . . . "2019_Khan_etal_JCTC" . "RSA" . "MIIBIjANBgkqhkiG9w0BAQEFAAOCAQ8AMIIBCgKCAQEAxszSDYX5tuCSkP7UiCtftYPFNQVTjgNu0I5fwdML2DLRDlp0xzmsQXRk8oHuvwGvG1aMjj6cpUqO+0rz2Sg/wvHOgUpkRH8VJXvmlkhafMLCMtUtk5JIx7e+fkzCby+fnmD7kMkGLrT+OaExWwEDmNlCAt0TPKcHSdwsjso2isXjtAsGevyCMke8ufnFYpjs746JES1eNzVnHnn2Kp/lqcm60GM+J8dLgRZp7fX0anW098xhKym6+xXFzqeju0vYRIHBPerv+r7skWxwk+a7Sd8msqVeYEv6NTqnyWvyWb6Yh8cvj04N6qm/T6C5FUPLQhzSaQgMVMU6yLqjPuu9DwIDAQAB" . "Z6P993gm/edEypI9FcqZLjwI0dxF/kl3uUdPg+s1Sy8BpC3AXchK23uTlU7IbXhfhbI6mgPn+lLoUvo4Uk/tkPjts3l6gH6EoEJIgHXNEyo4mbT2J9Oxpb5LmU+3WQ///lxlTR5v3a97wyZR9LZAY5SRupFY0fIVe/ji4b8bOs4mCR11XOORYym+vQTrSD420fo+S0ZBCP6o3+d8aQVzneVGn/nyMg9GuJ+OzEppXkq/KkbBAVCWVxfpEFhUyCJABYB0FjRnypIC9snXzyNzgZdr8poJtwVUa7LqcwQDAyqQiD6iEJ6Kf0lolT8nLB7PgaBHQ8aZq5RFdjpgT9/8dg==" . . . . . . . "" . "Environmental research" . . "" . "Life sciences" . . "" . "Physical sciences" . . "service-account-enrichment" . . . . . . "7833"^^ . "https://api.rohub.org/api/ros/d5486b94-4c58-4cb4-8b1e-6945adf5eba9/crate/download/" . . "2022-03-22 02:19:17.388294+00:00" . "2025-03-05 01:19:14.776191+00:00" . "2022-03-22 02:19:17.388294+00:00" . "This dataset contains molecular dynamic simulation data of Loxosceles phospholipase D enzymes, of both clades, in presence of different bilayer compositions. The enzymes simulated are Li_alphaIA1, St_beta1B1, Ll_alphaIII and R44Y/S60Y St_beta1B1. The bilayers are used are a pure POPC, PC:SM:CHOL (70:20:10) and POPC:POPE (50:50) bilayer. The trajectories are in DCD format and the topology file in PSF format.The following simulations are available: \n 1. Li_alphaIA1 on a pure POPC bilayer;\n 2. Li_alphaIA1 on a PC:SM:CHOL (70:20:10) bilayer;\n 3. Li_alphaIA1 on a POPC:POPE (50:50) bilayer;\n 4. Ll_alphaIII on a pure POPC bilayer;\n 5. Ll_alphaIII on a PC:SM:CHOL (70:20:10) bilayer;\n 6. R44Y/S60Y St_beta1B1 on a pure POPC bilayer;\n 7. St_beta1B1 on a pure POPC bilayer;\n 8. St_beta1B1 on a PC:SM:CHOL (70:20:10) bilayer;\n 9. St_beta1B1 on a POPC:POPE (50:50) bilayer;" . "application/ld+json" . . . . . "https://w3id.org/ro-id/d5486b94-4c58-4cb4-8b1e-6945adf5eba9" . . "Specificity of Loxosceles alpha clade phospholipase D enzymes for choline-containing lipids: role of a conserved aromatic cage" . "MANUAL" . "bilayer" . "choline" . "clade" . "dataset" . "enzyme" . "information" . "lipid" . "phospholipase" . "simulation" . "earth sciences" . "Hardware" . "IT-computer sciences" . "Pope" . "Religious leader" . "POPC" . "S60Y St_beta1B1" . "bilayer" . "clade" . "enzyme" . "lipid" . "phospholipase" . "chemistry and materials" . "Loxosceles phospholipase d enzyme" . "POPC bilayer" . "bilayer composition" . "choline-containing lipid" . "pure POPC" . "Specificity of Loxosceles alpha clade phospholipase D enzymes for choline-containing lipids: role of a conserved aromatic cage." . "The bilayers are used are a pure POPC, PC:SM:CHOL (70:20:10) and POPC:POPE (50:50) bilayer." . "This dataset contains molecular dynamic simulation data of Loxosceles phospholipase D enzymes, of both clades, in presence of different bilayer compositions." . . . . . . "biochemistry" . "Emmanuel Moutoussamy. \"Specificity of Loxosceles alpha clade phospholipase D enzymes for choline-containing lipids: role of a conserved aromatic cage.\" ROHub. Mar 22 ,2022. https://w3id.org/ro-id/d5486b94-4c58-4cb4-8b1e-6945adf5eba9." . "metadata" . . . "biblio" . . . . "data" . . . "raw data" . . . "Moutoussamy, E. (2021).Specificity of Loxosceles alpha clade phospholipase D enzymes for choline-containing lipids: role of a conserved aromatic cage [Data set]. Norstore. https://doi.org/10.11582/2021.00099" . "Nathalie Reuter" . "Simulation" . . "https://archive.sigma2.no/pages/public/datasetDetail.jsf?id=10.11582/2021.00099" . . "2021-11-19 00:00:00" . "2022-03-22 02:19:33.483910+00:00" . "This dataset contains molecular dynamic simulation data of Loxosceles phospholipase D enzymes, of both clades, in presence of different bilayer compositions. The enzymes simulated are Li_alphaIA1, St_beta1B1, Ll_alphaIII and R44Y/S60Y St_beta1B1. The bilayers are used are a pure POPC, PC:SM:CHOL (70:20:10) and POPC:POPE (50:50) bilayer. The trajectories are in DCD format and the topology file in PSF format.The following simulations are available: \n 1. Li_alphaIA1 on a pure POPC bilayer;\n 2. Li_alphaIA1 on a PC:SM:CHOL (70:20:10) bilayer;\n 3. Li_alphaIA1 on a POPC:POPE (50:50) bilayer;\n 4. Ll_alphaIII on a pure POPC bilayer;\n 5. Ll_alphaIII on a PC:SM:CHOL (70:20:10) bilayer;\n 6. R44Y/S60Y St_beta1B1 on a pure POPC bilayer;\n 7. St_beta1B1 on a pure POPC bilayer;\n 8. St_beta1B1 on a PC:SM:CHOL (70:20:10) bilayer;\n 9. St_beta1B1 on a POPC:POPE (50:50) bilayer;" . . "Specificity of Loxosceles alpha clade phospholipase D enzymes for choline-containing lipids: role of a conserved aromatic cage" . "2021-11-19 00:00:00" . . . . "Emmanuel Edouard Moutoussamy" . . . . "emmanuel.moutoussamy@rohub.com" . "Emmanuel Moutoussamy" . . "Geo H." . . . "2026-05-19T13:47:44.687+02:00"^^ . . . . . "Specificity of Loxosceles alpha clade phospholipase D enzymes for choline-containing lipids: role of a conserved aromatic cage" . "RSA" . "MIIBIjANBgkqhkiG9w0BAQEFAAOCAQ8AMIIBCgKCAQEAxszSDYX5tuCSkP7UiCtftYPFNQVTjgNu0I5fwdML2DLRDlp0xzmsQXRk8oHuvwGvG1aMjj6cpUqO+0rz2Sg/wvHOgUpkRH8VJXvmlkhafMLCMtUtk5JIx7e+fkzCby+fnmD7kMkGLrT+OaExWwEDmNlCAt0TPKcHSdwsjso2isXjtAsGevyCMke8ufnFYpjs746JES1eNzVnHnn2Kp/lqcm60GM+J8dLgRZp7fX0anW098xhKym6+xXFzqeju0vYRIHBPerv+r7skWxwk+a7Sd8msqVeYEv6NTqnyWvyWb6Yh8cvj04N6qm/T6C5FUPLQhzSaQgMVMU6yLqjPuu9DwIDAQAB" . "i3QJDEoGgh0Okmrs9Lk9HW+ouJnp5OMWjQa/YuilJTSou0FoNRdk2aMgdxpqgYtz4dgp8Zk2igAqXKXkRJx8WtMmAb9zhFDj5RwxTldyTIRkVDGjx8tZjxbz1+/SWGbfu+xDc0kRN2y4+06Fk9Yo5ULn2hFixbOe67JxkK9axrnvd9Jdk1OMEXaL47WUzbLznkN6LJe+s3R95BitifOn+9To0BIKiUvkBF6V7XJrP0aKx9ygpvGXQrtTmIpqCgPCZqLTT8LdXL5lIKEIEy6TisY9cY8yIdiZfMCLJicIhg3huXfVE1CbnAWqJrCySZKksF06vrS/02NZkqQ9XxPfxw==" . . . . . . . "" . "Environmental research" . . "" . "Life sciences" . . "" . "Physical sciences" . . "" . "Earth sciences" . . . "Norway" . . "debris flow field observation" . . "calculations data" . . "geology" . . "West Norway" . . "RAMMS simulation" . . "slide deposit" . . "measure" . . "perimeter" . . "data" . . "mudslide" . . "sediment" . . "data type" . . "treatise" . . "angle of repose" . . "domain" . . "dataset" . . "GNSS measurement" . . "profile" . "Department of Geosciences" . . . "Oslo" . . "calculation" . "University of Oslo" . . "service-account-enrichment" . . . . . . . "8150"^^ . "https://api.rohub.org/api/ros/fc0d05e2-f5b4-4b47-b520-ea9d05d9f707/crate/download/" . . "2022-03-22 02:21:05.280489+00:00" . "2025-03-05 00:50:09.588296+00:00" . "2022-03-22 02:21:05.280489+00:00" . "Data created for Marius Julian Grønli’s Master thesis at the Department of Geosciences at the University of Oslo fall 2021. \nTitle: Quantitative back calculation of three debris flows in western Norway\n\nDataset includes:\n\tGNSS measurements of three debris flows on the west coast of Norway. Logged perimeter with 15 m increments and several profiles across the flow paths. \n\tGrain size distribution, angle of repose for several soil samples at each study site. Including samples of slide deposits and Origin material.\n\tRAMMS simulations of the three events with varying input parameters. \n\nEach data type has a documentation file explaining the workflow of each data set.\n\n\nEvent dates:\n\tStamnes: 16th of February 2020\n\tJordalen: 5th of August 2019\n\tOsdalsvatenet: 21st of January 2020" . "application/ld+json" . . . . . "https://w3id.org/ro-id/fc0d05e2-f5b4-4b47-b520-ea9d05d9f707" . . "Debris flow field observations and RAMMS back calculations" . "MANUAL" . . . . . . "Marius Julian Grønli. \"Debris flow field observations and RAMMS back calculations.\" ROHub. Mar 22 ,2022. https://w3id.org/ro-id/fc0d05e2-f5b4-4b47-b520-ea9d05d9f707." . "raw data" . . . "biblio" . . . "metadata" . . . . "data" . . . "Grønli, M. J. (2021).Debris flow field observations and RAMMS back calculations [Data set]. Norstore. https://doi.org/10.11582/2021.00092" . "Marius Julian Grønli" . "Simulation" . . "https://archive.sigma2.no/pages/public/datasetDetail.jsf?id=10.11582/2021.00092" . . "2021-10-14 00:00:00" . "2022-03-22 02:21:24.160454+00:00" . "Data created for Marius Julian Grønli’s Master thesis at the Department of Geosciences at the University of Oslo fall 2021. \nTitle: Quantitative back calculation of three debris flows in western Norway\n\nDataset includes:\n\tGNSS measurements of three debris flows on the west coast of Norway. Logged perimeter with 15 m increments and several profiles across the flow paths. \n\tGrain size distribution, angle of repose for several soil samples at each study site. Including samples of slide deposits and Origin material.\n\tRAMMS simulations of the three events with varying input parameters. \n\nEach data type has a documentation file explaining the workflow of each data set.\n\n\nEvent dates:\n\tStamnes: 16th of February 2020\n\tJordalen: 5th of August 2019\n\tOsdalsvatenet: 21st of January 2020" . . "Debris flow field observations and RAMMS back calculations" . "2021-10-14 00:00:00" . . . . "Marius Julian Grønli" . . . . "Geo H." . . "marius.julian.gronli@rohub.com" . "Marius Julian Grønli" . . . "2026-05-19T13:47:44.443+02:00"^^ . . . . . "Debris flow field observations and RAMMS back calculations" . "RSA" . "MIIBIjANBgkqhkiG9w0BAQEFAAOCAQ8AMIIBCgKCAQEAxszSDYX5tuCSkP7UiCtftYPFNQVTjgNu0I5fwdML2DLRDlp0xzmsQXRk8oHuvwGvG1aMjj6cpUqO+0rz2Sg/wvHOgUpkRH8VJXvmlkhafMLCMtUtk5JIx7e+fkzCby+fnmD7kMkGLrT+OaExWwEDmNlCAt0TPKcHSdwsjso2isXjtAsGevyCMke8ufnFYpjs746JES1eNzVnHnn2Kp/lqcm60GM+J8dLgRZp7fX0anW098xhKym6+xXFzqeju0vYRIHBPerv+r7skWxwk+a7Sd8msqVeYEv6NTqnyWvyWb6Yh8cvj04N6qm/T6C5FUPLQhzSaQgMVMU6yLqjPuu9DwIDAQAB" . "UzgDBbK6gPwYkjti/wpHVGaIv/VqchhhEV5IOiHDtybVBKHCmMsMQqDpP/z0lxV1u84ZawCJOKadu2vH9yN8uZhiC+PVHTfrOoTFJTiXu43fnFjCMHLMOQdaJYAerKM0escpueWItyUET1Fsz3uQ/YP8k87pgx8zU4IohxqpRzwUkwtU8lsUzNvuZD+zw463RZdYSt0O0QxSe6rYmCeSL2WDnX0ZG5ebcaYSDA0cgyzvNB/ygfZ7uc2qAXPYSaj0xANgoRlHrrYcPI6dgc0gVfqSSsz6jW9ssjWMVCTj0JC6LccaxXdjNw4aG5BUGp/WwuV8u5dUJp8cl+/RgGIGZg==" . . . . . . . "" . "Environmental research" . . "" . "Life sciences" . . "" . "Physical sciences" . . "publication" . . "12.651821862348179" . "12.5" . "data for the publication" . . "11.322645290581162" . "11.3" . "computer modelling" . . "24.898785425101217" . "24.6" . "experiment" . . "29.322548028311424" . "29.0" . "data" . . "33.46814964610718" . "33.1" . "service-account-enrichment" . . . . . . "7174"^^ . "https://api.rohub.org/api/ros/5e8cbd3f-7b47-4d75-976a-b3d2c1d207e9/crate/download/" . . "2022-03-22 02:21:25.532255+00:00" . "2025-03-05 00:45:26.451604+00:00" . "2022-03-22 02:21:25.532255+00:00" . "raw experiment/simulation data for the publication" . "application/ld+json" . . . . . "https://w3id.org/ro-id/5e8cbd3f-7b47-4d75-976a-b3d2c1d207e9" . . "2012_Grauffel_etal_PLoSONE" . "MANUAL" . . . . . . "https://w3id.org/ro-id/df41cd03-d30a-42df-9c90-70a3a34bfe9f" . "https://w3id.org/ro-id/118fb288-3b7c-4e01-8a2d-604ee92fdec6" . "https://w3id.org/ro-id/24d62ac8-ce28-468c-b126-d51d011d186f" . "https://w3id.org/ro-id/bd9594b0-a34c-4a13-9e05-1f53a8a7cf77" . "https://w3id.org/ro-id/c3dbab5f-3057-475d-8d95-e81050e0af2c" . "https://w3id.org/ro-id/8e20766c-e0f4-4c8d-9ed1-2be1852aaaa6" . "https://w3id.org/ro-id/a2bd4f65-14ed-4820-ad2d-3d7c5eb57515" . "https://w3id.org/ro-id/4179efb5-d3c5-4ec7-90c1-29d0a08fa7c3" . "https://w3id.org/ro-id/5285a352-03c0-4dac-97f9-7c8a1176b0af" . "https://w3id.org/ro-id/6c5ad61d-9ed9-4975-96f0-72bf193f5d10" . "https://w3id.org/ro-id/9c06af6c-1ff6-4fd5-acc6-ec57b549da79" . "https://w3id.org/ro-id/d5d9a091-9e58-4a01-a8ed-728f8ec8dd8d" . "https://w3id.org/ro-id/e6948f96-6520-4b3f-9646-ddb3925dde31" . "https://w3id.org/ro-id/12fdff6e-f2ec-490d-b64b-7fa11480934b" . "https://w3id.org/ro-id/685b3d26-2957-47d4-bff7-4a355bebf2bb" . "https://w3id.org/ro-id/7d1d290d-bc88-48b2-8895-9ba409d88240" . "https://w3id.org/ro-id/d8911953-eb97-44fe-8dcd-16b624f19d22" . "Nathalie Reuter. \"2012_Grauffel_etal_PLoSONE.\" ROHub. Mar 22 ,2022. https://w3id.org/ro-id/5e8cbd3f-7b47-4d75-976a-b3d2c1d207e9." . "raw data" . . . "metadata" . . . . "biblio" . . . . "data" . . . "Reuter, N. (2021).2012_Grauffel_etal_PLoSONE [Data set]. Norstore. https://doi.org/10.11582/2021.00090" . "Nathalie Reuter" . "Simulation" . . "https://archive.sigma2.no/pages/public/datasetDetail.jsf?id=10.11582/2021.00090" . . "2021-10-13 00:00:00" . "2022-03-22 02:21:45.800191+00:00" . "raw experiment/simulation data for the publication" . . "2012_Grauffel_etal_PLoSONE" . "2021-10-13 00:00:00" . . . . "Nathalie Reuter" . . "https://doi.org/10.1371/journal.pone.0052642" . . "2022-03-22 02:21:40.999932+00:00" . "2022-03-22 02:21:41.269967+00:00" . . "https://doi.org/10.1371/journal.pone.0052642" . "2022-03-22 02:21:40.999932+00:00" . . . . . . . "simulation data" . . "88.27655310621243" . "88.1" . "simulation" . . "25.176946410515672" . "24.9" . "simulation data for the publication" . . "0.40080160320641284" . "0.4" . "earth sciences" . . "100.0" . "0.9631021022796631" . "publication" . . "12.032355915065722" . "11.9" . "atmospheric sciences" . . "100.0" . "0.9631021022796631" . "data" . . "31.781376518218625" . "31.4" . "experiment" . . "30.668016194331983" . "30.3" . "life sciences (general)" . . "100.0" . "0.756223201751709" . "2012_Grauffel_etal_PLoSONE. raw experiment/simulation data for the publication" . . "100.0" . "100.0" . "computer science" . . "100.0" . "16.0" . "life sciences" . . "100.0" . "0.756223201751709" . "Geo H." . . "nathalie.reuter@rohub.com" . "Nathalie Reuter" . . . "2026-05-19T13:47:44.094+02:00"^^ . . . . . "2012_Grauffel_etal_PLoSONE" . "RSA" . "MIIBIjANBgkqhkiG9w0BAQEFAAOCAQ8AMIIBCgKCAQEAxszSDYX5tuCSkP7UiCtftYPFNQVTjgNu0I5fwdML2DLRDlp0xzmsQXRk8oHuvwGvG1aMjj6cpUqO+0rz2Sg/wvHOgUpkRH8VJXvmlkhafMLCMtUtk5JIx7e+fkzCby+fnmD7kMkGLrT+OaExWwEDmNlCAt0TPKcHSdwsjso2isXjtAsGevyCMke8ufnFYpjs746JES1eNzVnHnn2Kp/lqcm60GM+J8dLgRZp7fX0anW098xhKym6+xXFzqeju0vYRIHBPerv+r7skWxwk+a7Sd8msqVeYEv6NTqnyWvyWb6Yh8cvj04N6qm/T6C5FUPLQhzSaQgMVMU6yLqjPuu9DwIDAQAB" . "xRuljEckrSP/60OUL7UA2EkFnZtl6bFGDM5eENU+9Sd9vMy5sm9BLHqqAnSBf/9SsejeMwBf4Sa4LgFiULfSQtilnVdIUcsb96RERAxU4Bqz5fhgIZW/0eX7zPsJHGQe0a7WqefoI4J344b+OTCeoMy/j6xysuzyUQAVJ4ZvgqeQNQbSrLhg90v7TO1TtJDJ8Jx/7H5RP4HD/GTi0sfT/RlEyvUmQTVgp37Wt99AwXa5sqJgtah8CfXuT4BlfHAECvC3u4ANdaFIEmx5OaJx3jl1g3GU2tjhhbtVs1iiEfRxiGbACLktQ1Ucu9pJWOWbe6c2iBQFirwQJQMf4rOzsA==" . . . . . . . "" . "Environmental research" . . "" . "Life sciences" . . "" . "Physical sciences" . . "" . "Earth sciences" . . "service-account-enrichment" . . . . . . . . "8544"^^ . "https://api.rohub.org/api/ros/c35062bf-df50-4667-b876-e5c69570125c/crate/download/" . . "2022-03-22 02:21:47.331157+00:00" . "2025-03-05 00:56:57.081384+00:00" . "2022-03-22 02:21:47.331157+00:00" . "This dataset contains the model output (atmospheric component only) used in \nBlichner, S. M., Sporre, M. K., and Berntsen, T. K.: Reduced effective radiative forcing from cloud-aerosol interactions (ERFaci) with improved treatment of early aerosol growth in an Earth System Model, Atmos. Chem. Phys., LINK: http://doi.org/10.5194/acp-2021-151, accepted, 2021.\n\nSee LINK: http://github.com/sarambl/OAS-ERF for analysis code." . "application/ld+json" . . . . . "https://w3id.org/ro-id/c35062bf-df50-4667-b876-e5c69570125c" . . "Model output for \"Reduced effective radiative forcing from cloud-aerosol interactions (ERFaci) with improved treatment of early aerosol growth in an Earth System Model\"" . "MANUAL" . "aerosol" . "cloud" . "interaction" . "output" . "radiative forcing" . "therapy" . "tumor" . "earth sciences" . "Therapy" . "T. K. Reduced" . "aerosol" . "cloud" . "growth" . "interaction" . "radiative forcing" . "treatment" . "mathematical and computer sciences" . "Chem. Phys" . "aerosol growth" . "cloud-aerosol interaction" . "improved treatment" . "model output" . "Blichner, S. M. Sporre, M. K. and Berntsen, T. K. Reduced effective radiative forcing from cloud-aerosol interactions (ERFaci) with improved treatment of early aerosol growth in an Earth System Model, Atmos." . "Model output for \"Reduced effective radiative forcing from cloud-aerosol interactions (ERFaci) with improved treatment of early aerosol growth in an Earth System Model\" This dataset contains the model output (atmospheric component only) used in" . "See LINK: http: github.com/sarambl/OAS-ERF for analysis code." . . . . . . "medicine" . "physics" . "Sara Blichner, and University of Oslo (UiO). \"Model output for \"Reduced effective radiative forcing from cloud-aerosol interactions (ERFaci) with improved treatment of early aerosol growth in an Earth System Model\".\" ROHub. Mar 22 ,2022. https://w3id.org/ro-id/c35062bf-df50-4667-b876-e5c69570125c." . "raw data" . . . "metadata" . . . . "data" . . . . "biblio" . . . . "https://acp.copernicus.org/preprints/acp-2021-151/" . . "2022-03-22 02:22:07.384799+00:00" . "2022-03-22 02:22:07.648299+00:00" . . "https://acp.copernicus.org/preprints/acp-2021-151/" . "2022-03-22 02:22:07.384799+00:00" . . . . "Blichner, S., University of Oslo (2021).Model output for \"Reduced effective radiative forcing from cloud-aerosol interactions (ERFaci) with improved treatment of early aerosol growth in an Earth System Model\" [Data set]. Norstore. https://doi.org/10.11582/2021.00087" . "Sara Marie Blichner" . "Simulation" . . "https://archive.sigma2.no/pages/public/datasetDetail.jsf?id=10.11582/2021.00087" . . "2021-10-11 00:00:00" . "2022-03-22 02:22:11.450221+00:00" . "This dataset contains the model output (atmospheric component only) used in \nBlichner, S. M., Sporre, M. K., and Berntsen, T. K.: Reduced effective radiative forcing from cloud-aerosol interactions (ERFaci) with improved treatment of early aerosol growth in an Earth System Model, Atmos. Chem. Phys., LINK, accepted, 2021.\n\nSee LINK for analysis code." . . "Model output for \"Reduced effective radiative forcing from cloud-aerosol interactions (ERFaci) with improved treatment of early aerosol growth in an Earth System Model\"" . "2021-10-11 00:00:00" . . . . "Sara Marie Blichner" . . . . "UiO@rohub.com" . "University of Oslo (UiO)" . . "Geo H." . . "sara.blichner@rohub.com" . "Sara Blichner" . . . "2026-05-19T13:47:43.799+02:00"^^ . . . . . "Model output for \"Reduced effective radiative forcing from cloud-aerosol interactions (ERFaci) with improved treatment of early aerosol growth in an Earth System Model\"" . "RSA" . "MIIBIjANBgkqhkiG9w0BAQEFAAOCAQ8AMIIBCgKCAQEAxszSDYX5tuCSkP7UiCtftYPFNQVTjgNu0I5fwdML2DLRDlp0xzmsQXRk8oHuvwGvG1aMjj6cpUqO+0rz2Sg/wvHOgUpkRH8VJXvmlkhafMLCMtUtk5JIx7e+fkzCby+fnmD7kMkGLrT+OaExWwEDmNlCAt0TPKcHSdwsjso2isXjtAsGevyCMke8ufnFYpjs746JES1eNzVnHnn2Kp/lqcm60GM+J8dLgRZp7fX0anW098xhKym6+xXFzqeju0vYRIHBPerv+r7skWxwk+a7Sd8msqVeYEv6NTqnyWvyWb6Yh8cvj04N6qm/T6C5FUPLQhzSaQgMVMU6yLqjPuu9DwIDAQAB" . "xrpJVjad+ErSksg2MgfCncTmFT61nBXKVxsbIqSesv167HRM9+ld0JV6wqCImJaKbDXnmNS7ItXxq7yeZgDTW5Ai231itVJqALoNOPX2gEwNvPVda00dM0M28kqAZjWB1r+hR8wiOUgGvuLqw1oEIKV/Ay0+xGAQmU10RFfUKwl4JVib0ClGealJjYXwKhAW8uLJi001i77jRgtsHReSPE9ll/MBClbIoYOJ4xnu44gFyhY9dtGa+g6U0Krsv0NOMHDDXR3mMpuoXQlBrvMWIE0WN4BaFMvaDBsqODv/CQ/82ykLbXLVxZWoR8OEAl6Gr7W7t8BrBe3bo4ivdqFUAw==" . . . . . . . "" . "Environmental research" . . "" . "Life sciences" . . "" . "Physical sciences" . . "" . "Chemistry" . . "computer modelling" . . "16.75025075225677" . "16.7" . "computer science" . . "29.648241206030153" . "11.8" . "mathematical and computer sciences" . . "100.0" . "0.29949691891670227" . "manuscript" . . "7.321965897693079" . "7.3" . "source code" . . "38.581856100104275" . "37.0" . "atmospheric sciences" . . "100.0" . "0.7998380064964294" . "analysis data" . . "35.03503503503503" . "35.0" . "manuscript" . . "7.7163712200208545" . "7.4" . "source code" . . "36.91073219658976" . "36.8" . "computer programming and software" . . "100.0" . "0.29949691891670227" . "source simulation" . . "64.96496496496498" . "64.9" . "publication" . . "6.673618352450469" . "6.4" . "simulation" . . "18.039624608967674" . "17.3" . "data" . . "28.988529718456725" . "27.8" . "IT-computer sciences" . . "Science and technology/Technology and engineering/IT-computer sciences" . "service-account-enrichment" . . . . . . . "7302"^^ . "https://api.rohub.org/api/ros/bc9a215f-a0b0-4a5b-85e9-668f59874669/crate/download/" . . "2022-03-22 02:22:13.239874+00:00" . "2025-03-05 00:45:27.011181+00:00" . "2022-03-22 02:22:13.239874+00:00" . "source simulation files, analysis data, source code, manuscript etc. for the publication" . "application/ld+json" . . . . . "https://w3id.org/ro-id/bc9a215f-a0b0-4a5b-85e9-668f59874669" . . "2013_Fuglebakk_Reuter_Hinsen_JCTC" . "MANUAL" . . . . . . "https://w3id.org/ro-id/21c7efbc-5b32-4252-80de-54332db3c22e" . "https://w3id.org/ro-id/be1f0560-2efb-451a-a480-fbb59273aa12" . "https://w3id.org/ro-id/0e60f9a3-f509-473d-9a01-daa3b9af0c71" . "https://w3id.org/ro-id/2f981695-fcdb-4a4d-a62a-a416209dff5f" . "https://w3id.org/ro-id/91ff8e38-d049-4480-8c58-a03a85c6d88d" . "https://w3id.org/ro-id/d44514a5-4fa2-4f20-ba70-9f65dc27e197" . "https://w3id.org/ro-id/d6888ca3-5ceb-4084-b28b-78afa529f035" . "https://w3id.org/ro-id/d708cc8d-b7c1-4844-874e-386804236c5d" . "https://w3id.org/ro-id/81b43073-1f12-4ec3-bda0-31871849c11b" . "https://w3id.org/ro-id/e80c508a-eca3-422c-beda-5efab23b0e1f" . "https://w3id.org/ro-id/b1205b18-910f-49c5-b884-3f07f974e3e2" . "https://w3id.org/ro-id/702af2a6-4a74-491c-98c7-6ff822826ed6" . "https://w3id.org/ro-id/8b4f92fc-157c-4f04-90b9-1374279a7827" . "https://w3id.org/ro-id/9ff7e001-1a91-49bc-a62a-64545b49363a" . "https://w3id.org/ro-id/aca95257-9b1b-4273-b9e4-bc9e3cb28849" . "https://w3id.org/ro-id/b01a20c5-99b9-4550-8b4c-2eed1451cc07" . "https://w3id.org/ro-id/2a3e1c91-9dd8-4008-a413-921498379217" . "https://w3id.org/ro-id/9ab04305-2c0f-4079-87dd-2c08edbf499d" . "https://w3id.org/ro-id/844ae3d8-ebe8-46c9-904d-06f0515adb07" . "https://w3id.org/ro-id/9da1ffd8-f477-445b-88b3-138e0db8ff94" . "https://w3id.org/ro-id/fb3dea67-85bc-40ab-b9b2-75efecaf7471" . "Nathalie Reuter. \"2013_Fuglebakk_Reuter_Hinsen_JCTC.\" ROHub. Mar 22 ,2022. https://w3id.org/ro-id/bc9a215f-a0b0-4a5b-85e9-668f59874669." . . "data" . . . "metadata" . . . . "biblio" . . . "raw data" . . . "Reuter, N. (2021).2013_Fuglebakk_Reuter_Hinsen_JCTC [Data set]. Norstore. https://doi.org/10.11582/2021.00085" . "Nathalie Reuter" . "Simulation" . . "https://archive.sigma2.no/pages/public/datasetDetail.jsf?id=10.11582/2021.00085" . . "None" . "2022-03-22 02:22:36.027755+00:00" . "source simulation files, analysis data, source code, manuscript etc. for the publication" . . "2013_Fuglebakk_Reuter_Hinsen_JCTC" . "None" . . . . "Nathalie Reuter" . . "https://doi.org/10.1021/ct400399x" . . "2022-03-22 02:22:31.146218+00:00" . "2022-03-22 02:22:31.420467+00:00" . . "https://doi.org/10.1021/ct400399x" . "2022-03-22 02:22:31.146218+00:00" . . . . . . . "computer programming" . . "70.35175879396985" . "28.0" . "publication" . . "6.41925777331996" . "6.4" . "data" . . "28.68605817452357" . "28.6" . "analysis" . . "3.9117352056168504" . "3.9" . "earth sciences" . . "100.0" . "0.7998380064964294" . "2013_Fuglebakk_Reuter_Hinsen_JCTC. source simulation files, analysis data, source code, manuscript etc. for the publication" . . "100.0" . "100.0" . "Geo H." . . "nathalie.reuter@rohub.com" . "Nathalie Reuter" . . . "2026-05-19T13:47:43.537+02:00"^^ . . . . . "2013_Fuglebakk_Reuter_Hinsen_JCTC" . "RSA" . "MIIBIjANBgkqhkiG9w0BAQEFAAOCAQ8AMIIBCgKCAQEAxszSDYX5tuCSkP7UiCtftYPFNQVTjgNu0I5fwdML2DLRDlp0xzmsQXRk8oHuvwGvG1aMjj6cpUqO+0rz2Sg/wvHOgUpkRH8VJXvmlkhafMLCMtUtk5JIx7e+fkzCby+fnmD7kMkGLrT+OaExWwEDmNlCAt0TPKcHSdwsjso2isXjtAsGevyCMke8ufnFYpjs746JES1eNzVnHnn2Kp/lqcm60GM+J8dLgRZp7fX0anW098xhKym6+xXFzqeju0vYRIHBPerv+r7skWxwk+a7Sd8msqVeYEv6NTqnyWvyWb6Yh8cvj04N6qm/T6C5FUPLQhzSaQgMVMU6yLqjPuu9DwIDAQAB" . "EBj9oFXgvHqvs+oAEMPi0HjJHm0RxfOqg2oEY4HSleha5vdXYiR5zkPqCutJNpr6bEhCThbaeBU7C8j/sQWgJxQ+D9FvKUdN+3qOIS/F5M7OhK0evTtBMpp56Y/9OAKRLpEFY/HuI6lfQXkMPW0Z5Q9WGmBqkCrJFmApE1Y3PojfTzSS3K+xNwPqKMVGDmiizrGRpSyC5gYa1LXq+ZG3ayKFwpNG3Sz3dUm6+dlj7Ofj2g5eOfGBruOx2gDYbC98//q4KthBk04F3UFYa1y+/bRwMtVMhUvYfm6h0wMY9x6Kz65joWmFpk+ntcJ9IP7c2qwozFNuxVGo8JkO0HD2FA==" . . . . . . . "mailto:nathalie.reuter@rohub.com" . "7203"^^ . "https://api.rohub.org/api/ros/359fc143-420a-45a9-8cdb-fc03c7188df5/crate/download/" . "mailto:georgehadib@gmail.com" . "2022-03-22 02:22:37.897281+00:00" . "2025-03-05 00:45:25.879983+00:00" . "2022-03-22 02:22:37.897281+00:00" . "source simulation/analysis data for the publication" . "application/ld+json" . . . . . . . "https://w3id.org/ro-id/359fc143-420a-45a9-8cdb-fc03c7188df5" . . "2009_Hajjar_Dejaegere_Reuter_JPCA" . "http://eurovoc.europa.eu/2919" . "http://eurovoc.europa.eu/3941" . "http://eurovoc.europa.eu/3946" . "http://eurovoc.europa.eu/5966" . "MANUAL" . . . . "https://w3id.org/ro-id/b598ff14-9f40-4dd4-9a51-c6c876d6c4f9" . "https://w3id.org/ro-id/2d2279a8-e28b-41b5-8d9b-c84d8c56b8cd" . "https://w3id.org/ro-id/8c471337-2d21-4603-af51-8c51424cbc15" . "https://w3id.org/ro-id/93d0b3c7-5dea-4858-9818-e71de222b644" . "https://w3id.org/ro-id/b71244db-b6a4-4983-ac77-8aff82f87827" . "https://w3id.org/ro-id/e87b3e9f-cd16-4868-8c58-cd48d7be649c" . "https://w3id.org/ro-id/4e238fdb-4e45-4543-85f9-56abf3a1c08b" . "https://w3id.org/ro-id/cc72f552-8791-47f5-b30a-26a4a0932ba5" . "https://w3id.org/ro-id/6829dc3e-b758-42a8-8f96-1accf4a2bca5" . "https://w3id.org/ro-id/87d5a9cb-bf7e-4817-a12c-95bc4f2a2e67" . "https://w3id.org/ro-id/8b5e5476-a79e-4512-9427-614a57ffc7e5" . "https://w3id.org/ro-id/dcb3f7ba-85af-42fb-9f23-bfbc19e7037c" . "https://w3id.org/ro-id/f342e568-22c4-4f61-b78c-511f0e6655c4" . "https://w3id.org/ro-id/a01cccbe-ac89-4399-b258-c4a5822d7d46" . "https://w3id.org/ro-id/ebcad90a-8c01-4dee-9547-bb3e6c1f2dcb" . "https://w3id.org/ro-id/d03cfd7d-7cad-411f-9af0-9621c4a2497f" . "https://w3id.org/ro-id/f9191935-e027-403b-9935-032cc2a49be6" . "https://w3id.org/ro-id/36bd90da-c1d0-4adc-82c4-14adf1a98f01" . "Nathalie Reuter. \"2009_Hajjar_Dejaegere_Reuter_JPCA.\" ROHub. Mar 22 ,2022. https://w3id.org/ro-id/359fc143-420a-45a9-8cdb-fc03c7188df5." . "raw data" . . . "data" . . . "metadata" . . . "biblio" . . . "Reuter, N. (2021).2009_Hajjar_Dejaegere_Reuter_JPCA [Data set]. Norstore. https://doi.org/10.11582/2021.00086" . "Published" . "Nathalie Reuter" . "Simulation" . "mailto:nathalie.reuter@rohub.com" . "https://archive.sigma2.no/pages/public/datasetDetail.jsf?id=10.11582/2021.00086" . "mailto:georgehadib@gmail.com" . "None" . "2022-03-22 02:22:57.660517+00:00" . "source simulation/analysis data for the publication" . "CC-BY-4.0" . "https://archive.sigma2.no/pages/public/datasetDetail.jsf?id=10.11582/2021.00086" . "None" . . . "Nathalie Reuter" . "Dandan Xue" . "mailto:nathalie.reuter@rohub.com" . "https://doi.org/10.1021/jp902930u" . "mailto:georgehadib@gmail.com" . "2022-03-22 02:22:52.717818+00:00" . "2022-03-22 02:22:52.997316+00:00" . "https://doi.org/10.1021/jp902930u" . "2022-03-22 02:22:52.717818+00:00" . . . . . . "Geo H." . . "nathalie.reuter@rohub.com" . "Nathalie Reuter" . . "mailto:service-account-enrichment" . . . "2026-05-19T13:47:43.251+02:00"^^ . . . . . "2009_Hajjar_Dejaegere_Reuter_JPCA" . "RSA" . "MIIBIjANBgkqhkiG9w0BAQEFAAOCAQ8AMIIBCgKCAQEAxszSDYX5tuCSkP7UiCtftYPFNQVTjgNu0I5fwdML2DLRDlp0xzmsQXRk8oHuvwGvG1aMjj6cpUqO+0rz2Sg/wvHOgUpkRH8VJXvmlkhafMLCMtUtk5JIx7e+fkzCby+fnmD7kMkGLrT+OaExWwEDmNlCAt0TPKcHSdwsjso2isXjtAsGevyCMke8ufnFYpjs746JES1eNzVnHnn2Kp/lqcm60GM+J8dLgRZp7fX0anW098xhKym6+xXFzqeju0vYRIHBPerv+r7skWxwk+a7Sd8msqVeYEv6NTqnyWvyWb6Yh8cvj04N6qm/T6C5FUPLQhzSaQgMVMU6yLqjPuu9DwIDAQAB" . "Yur0JKoq7JrYo4aecI82SRhJ98EwJBzUrp5n61xljNCfzEaBaxZrIAIGhfXS5M8sr2GxkuEGcIhbE8Ns5C1qFMiW2Mf2cBj1G+fneVLRm+f4XS9QFXdhNngMTfMAVrfYKHrdKrhqE0sGhcrG1D7+ZGKmtl5jBSefA+NVZQGHcWQ6WQQYHyw/U4us9Tc4Ema/E0gxG3uEiHhNb2VML42/h7CRMkXVPjNd6wqej7EwiYFbIktLjzwby1PAa09wj7ZqsdcsDMhS+wyJz4z3MzeMxQF3kAlrpWQBg6tSBkuW/2ibu8uXZD7bEjTyvP5MZv/N6WFcNzkXYrgfLfqpOd6iIQ==" . . . . . . . "" . "Environmental research" . . "" . "Life sciences" . . "" . "Physical sciences" . . "" . "Earth sciences" . . "service-account-enrichment" . . . . . . . "8000"^^ . "https://api.rohub.org/api/ros/e7f5d844-fa99-4407-af00-82fc4ba618f1/crate/download/" . . "2022-03-22 02:22:59.259226+00:00" . "2025-03-05 01:23:33.595114+00:00" . "2022-03-22 02:22:59.259226+00:00" . "Sea-level pressure, SST, latent and sensible heat fluxes, large-scale and convective precipitation, specific humidity and temperatures at 850 hPa, and winds at both 925 and 300 hPa from the AFES simulations. In addition to a control simulation with realistic SST, there is one simulation each with strongly smoothed SSTs in either the Gulf Stream or Kuroshio Extension region. All simulations cover the time period 1982-2000." . "application/ld+json" . . . . . "https://w3id.org/ro-id/e7f5d844-fa99-4407-af00-82fc4ba618f1" . . "Subset of the AFES simulations used for doi 10.5194/wcd-2020-50" . "MANUAL" . "Gulf stream" . "latent heat" . "precipitation" . "pressure" . "sea surface temperature" . "simulation" . "subset" . "supersonic transport aircraft" . "temperature" . "earth sciences" . "Weather" . "AFES" . "Gulf stream" . "SST" . "doi 10.5194" . "hPa" . "simulation" . "subset" . "geosciences" . "AFES simulation" . "Kuroshio Extension region" . "convective precipitation" . "sensible heat fluxes" . "smoothed SST" . "In addition to a control simulation with realistic SST, there is one simulation each with strongly smoothed SSTs in either the Gulf Stream or Kuroshio Extension region." . "Sea-level pressure, SST, latent and sensible heat fluxes, large-scale and convective precipitation, specific humidity and temperatures at 850 hPa, and winds at both 925 and 300 hPa from the AFES simulations." . "Subset of the AFES simulations used for doi 10.5194/wcd-2020-50." . "the time period 1982-2000" . . . . . . "meteorology" . "physics" . "Akira Kuwano-Yoshida. \"Subset of the AFES simulations used for doi 10.5194/wcd-2020-50.\" ROHub. Mar 22 ,2022. https://w3id.org/ro-id/e7f5d844-fa99-4407-af00-82fc4ba618f1." . "metadata" . . . . "biblio" . . . "raw data" . . . . "data" . . . "Kuwano-Yoshida, A. (2021).Subset of the AFES simulations used for doi 10.5194/wcd-2020-50 [Data set]. Norstore. https://doi.org/10.11582/2021.00075" . "Akira Kuwano-Yoshida" . "Simulation" . . "https://archive.sigma2.no/pages/public/datasetDetail.jsf?id=10.11582/2021.00075" . . "2021-09-22 00:00:00" . "2022-03-22 02:23:18.675518+00:00" . "Sea-level pressure, SST, latent and sensible heat fluxes, large-scale and convective precipitation, specific humidity and temperatures at 850 hPa, and winds at both 925 and 300 hPa from the AFES simulations. In addition to a control simulation with realistic SST, there is one simulation each with strongly smoothed SSTs in either the Gulf Stream or Kuroshio Extension region. All simulations cover the time period 1982-2000." . . "Subset of the AFES simulations used for doi 10.5194/wcd-2020-50" . "2021-09-22 00:00:00" . . . . "Clemens Spensberger" . . "https://wcd.copernicus.org/preprints/wcd-2020-50/" . . "2022-03-22 02:23:14.397390+00:00" . "2022-03-22 02:23:14.649349+00:00" . . "https://wcd.copernicus.org/preprints/wcd-2020-50/" . "2022-03-22 02:23:14.397390+00:00" . . . . . . . "akira.kuwano-yoshida@rohub.com" . "Akira Kuwano-Yoshida" . . "Geo H." . . . "2026-05-19T13:47:42.973+02:00"^^ . . . . . "Subset of the AFES simulations used for doi 10.5194/wcd-2020-50" . "RSA" . "MIIBIjANBgkqhkiG9w0BAQEFAAOCAQ8AMIIBCgKCAQEAxszSDYX5tuCSkP7UiCtftYPFNQVTjgNu0I5fwdML2DLRDlp0xzmsQXRk8oHuvwGvG1aMjj6cpUqO+0rz2Sg/wvHOgUpkRH8VJXvmlkhafMLCMtUtk5JIx7e+fkzCby+fnmD7kMkGLrT+OaExWwEDmNlCAt0TPKcHSdwsjso2isXjtAsGevyCMke8ufnFYpjs746JES1eNzVnHnn2Kp/lqcm60GM+J8dLgRZp7fX0anW098xhKym6+xXFzqeju0vYRIHBPerv+r7skWxwk+a7Sd8msqVeYEv6NTqnyWvyWb6Yh8cvj04N6qm/T6C5FUPLQhzSaQgMVMU6yLqjPuu9DwIDAQAB" . "AeQouEUCGeDbAso4vMPi/FLmMkK1lpkTH7yQ2sURG8G258T9d9m/+iqrqga2Sv+31Tb7pmnLau4l2ikT9IrkbTxR9XHdZLxKTVjB8y2014MQnk8FCPpFzgmbQ70r+8ZbiHgEWS4/qrA9mZ03lNFTXRA+oSRmp1Fuf4br6/L58IfKy4/pkfUCJ7o2FOo7zcHpFGqAWzCOi1DrwcZqzB71V2UppO0lfSgdjnNg7Echiy6ti5zJ6/8YdtRpYSXyxEys1amO/AYIlXAYqno2pz8QKSJV9vnwq3hX24aZOm6XvqzclwQzy4suq9CJCrepMv2Pv/SreRsVlquRJgeN7nCUzg==" . . . . . . . "" . "Environmental research" . . "" . "Life sciences" . . "" . "Physical sciences" . . "" . "Earth sciences" . . "service-account-enrichment" . . . . . . . . . "8136"^^ . "https://api.rohub.org/api/ros/c0f7a882-6123-477c-aac5-25e8f9e49dcd/crate/download/" . . "2022-03-22 02:23:20.356464+00:00" . "2025-03-05 12:49:07.078365+00:00" . "2022-03-22 02:23:20.356464+00:00" . "The data set contains wind power related variables for the North Sea, the Norwegian Sea, and parts of the Barents Sea. The user is encourage to read the README file contained within the data set." . "application/ld+json" . . . . . "https://w3id.org/ro-id/c0f7a882-6123-477c-aac5-25e8f9e49dcd" . . "Norwegian hindcast archive's wind power data set (NORA3-WP)" . "MANUAL" . "Barents Sea" . "North Sea" . "Norwegian Sea" . "archive file" . "dataset" . "hindcast" . "user" . "variable" . "wind power" . "earth sciences" . "Alternative energy" . "Hardware" . "IT-computer sciences" . "Renewable energy" . "Barents Sea" . "North Sea" . "Norwegian Sea" . "archive" . "data set" . "variable" . "wind power" . "mathematical and computer sciences" . "archive's wind power data set" . "contain wind power" . "hindcast archive's wind power data set" . "parts of the Barents Sea" . "related variable" . "Norwegian hindcast archive's wind power data set (NORA3-WP) The data set contains wind power related variables for the North Sea, the Norwegian Sea, and parts of the Barents Sea." . "The user is encourage to read the README file contained within the data set." . . . . . . "database" . "hydrography" . "software" . "Barents Sea" . "North Sea" . "Norwegian Sea" . "Ida Marie Solbrekke, Asgeir Sorteberg, and University of Bergen, Institute of biomedicine (UiB). \"Norwegian hindcast archive's wind power data set (NORA3-WP).\" ROHub. Mar 22 ,2022. https://w3id.org/ro-id/c0f7a882-6123-477c-aac5-25e8f9e49dcd." . "raw data" . . . "metadata" . . . "biblio" . . . . "data" . . . "Solbrekke, I. M., Sorteberg, A., University of Bergen (2021).Norwegian hindcast archive's wind power data set (NORA3-WP) [Data set]. Norstore. https://doi.org/10.11582/2021.00068" . "University of Bergen (UiB)" . "Simulation" . . "https://archive.sigma2.no/pages/public/datasetDetail.jsf?id=10.11582/2021.00068" . . "2021-08-25 00:00:00" . "2022-03-22 02:23:42.107526+00:00" . "The data set contains wind power related variables for the North Sea, the Norwegian Sea, and parts of the Barents Sea. The user is encourage to read the README file contained within the data set." . . "Norwegian hindcast archive's wind power data set (NORA3-WP)" . "2021-08-25 00:00:00" . . . . "Ida Marie Solbrekke" . . . . "UiB@rohub.com" . "University of Bergen, Institute of biomedicine (UiB)" . . "asgeir.sorteberg@rohub.com" . "Asgeir Sorteberg" . . "Geo H." . . "ida.marie.solbrekke@rohub.com" . "Ida Marie Solbrekke" . . . "2026-05-19T13:47:42.599+02:00"^^ . . . . . "Norwegian hindcast archive's wind power data set (NORA3-WP)" . "RSA" . "MIIBIjANBgkqhkiG9w0BAQEFAAOCAQ8AMIIBCgKCAQEAxszSDYX5tuCSkP7UiCtftYPFNQVTjgNu0I5fwdML2DLRDlp0xzmsQXRk8oHuvwGvG1aMjj6cpUqO+0rz2Sg/wvHOgUpkRH8VJXvmlkhafMLCMtUtk5JIx7e+fkzCby+fnmD7kMkGLrT+OaExWwEDmNlCAt0TPKcHSdwsjso2isXjtAsGevyCMke8ufnFYpjs746JES1eNzVnHnn2Kp/lqcm60GM+J8dLgRZp7fX0anW098xhKym6+xXFzqeju0vYRIHBPerv+r7skWxwk+a7Sd8msqVeYEv6NTqnyWvyWb6Yh8cvj04N6qm/T6C5FUPLQhzSaQgMVMU6yLqjPuu9DwIDAQAB" . "MDMoBqD6PWKgLTFUsyNGoz6qB3dGjb9dms/dizVIVJEdisXcSSykbVwf1Hzj+lvGnJeg0zIjYwa8NMeCt8t/rqdwjW+9EoxIO6db/wzVmuM+4xdfui2ypTIZYtO9CdDojaB9Nhl8b9kSmJUKuEqiU8Nvn3UKeZXeq7B401SYnv7I+u51R1UI+q5ZeYKK51EBuM2kcxGFK9PIxfIHrApzSUrOBvc8e/KyygWDLMJxQBQ3Mhh84+V2FVk0xZ7ZcX8CqoErg+cXWyv7XytgdZO7MA37Mf/8c2JDWIe2Iyguc470cE+T94hKFXrj7f7EL9KbEZ8HFi0M8mHc5rDWAkQWjQ==" . . . . . . . "" . "Environmental research" . . "" . "Life sciences" . . "" . "Physical sciences" . . "" . "Earth sciences" . . . "WRF model datum" . . "South America" . . "newspaper" . . "understanding" . . "fact" . . "Future Precipitation Projections for South America" . . "South America" . . "Understanding Model Diversity in Future Precipitation Projections" . . "further detail" . . "South America WRF model datum" . . "detail" . . "newspaper publisher" . "service-account-enrichment" . . . . . . . "7320"^^ . "https://api.rohub.org/api/ros/6b0cdc2d-2857-44ef-bc5a-c2051ad20ba9/crate/download/" . . "2022-03-22 02:23:45.142410+00:00" . "2025-03-05 02:47:01.794301+00:00" . "2022-03-22 02:23:45.142410+00:00" . "WRF model data used in the paper \"Understanding Model Diversity in Future Precipitation Projections for South America\", in review. Further details are given in the paper and in the README file." . "application/ld+json" . . . . . "https://w3id.org/ro-id/6b0cdc2d-2857-44ef-bc5a-c2051ad20ba9" . . "Understanding Model Diversity in Future Precipitation Projections for South America" . "MANUAL" . . . . . . "Center for International Climate Research (CICERO). \"Understanding Model Diversity in Future Precipitation Projections for South America.\" ROHub. Mar 22 ,2022. https://w3id.org/ro-id/6b0cdc2d-2857-44ef-bc5a-c2051ad20ba9." . "metadata" . . . "raw data" . . . "biblio" . . . . "data" . . . "Center for International Climate Research (2021).Understanding Model Diversity in Future Precipitation Projections for South America [Data set]. Norstore. https://doi.org/10.11582/2021.00067" . "Øivind Hodnebrog" . "Simulation" . . "https://archive.sigma2.no/pages/public/datasetDetail.jsf?id=10.11582/2021.00067" . . "2021-08-12 00:00:00" . "2022-03-22 02:24:01.479217+00:00" . "WRF model data used in the paper \"Understanding Model Diversity in Future Precipitation Projections for South America\", in review. Further details are given in the paper and in the README file." . . "Understanding Model Diversity in Future Precipitation Projections for South America" . "2021-08-12 00:00:00" . . . . "Øivind Hodnebrog" . . . . "CICERO@rohub.com" . "Center for International Climate Research (CICERO)" . . "Geo H." . . . "2026-05-19T13:47:42.294+02:00"^^ . . . . . "Understanding Model Diversity in Future Precipitation Projections for South America" . "RSA" . "MIIBIjANBgkqhkiG9w0BAQEFAAOCAQ8AMIIBCgKCAQEAxszSDYX5tuCSkP7UiCtftYPFNQVTjgNu0I5fwdML2DLRDlp0xzmsQXRk8oHuvwGvG1aMjj6cpUqO+0rz2Sg/wvHOgUpkRH8VJXvmlkhafMLCMtUtk5JIx7e+fkzCby+fnmD7kMkGLrT+OaExWwEDmNlCAt0TPKcHSdwsjso2isXjtAsGevyCMke8ufnFYpjs746JES1eNzVnHnn2Kp/lqcm60GM+J8dLgRZp7fX0anW098xhKym6+xXFzqeju0vYRIHBPerv+r7skWxwk+a7Sd8msqVeYEv6NTqnyWvyWb6Yh8cvj04N6qm/T6C5FUPLQhzSaQgMVMU6yLqjPuu9DwIDAQAB" . "GPj7opTF33+3JfOcWBxjc96ZSV0jgfJWAY/Bs0s4Mtk7/XTMbnXeYU6DqQDGXZga78yWq7qeeyRk/TjIgTdl8OI2UiwAPZ096hrIEoFEseJTAF+rZt2kDxlNMA0vjdTBBjv8xPCr3lxK9Dfn0T2ZYFsgxzH/50scqjKr5aLtUI/raajFFRDHQTZRc7/xTsT8SUD8qP8zizSH/A0ZuWYH+joH4n53oCia2hVLm/WYLd/cSA7bCltCyD1PyYhqQKEqg4L5zMCKrohDUBRjfdyA95eQZj8CuUTwmfr1wVzZpnPkunQ0WplxaHKREI6WaRh2sQEQyb/VgUcbtwbO3eZkRw==" . . . . . . . "" . "Environmental research" . . "" . "Life sciences" . . "" . "Physical sciences" . . "" . "Earth sciences" . . "service-account-enrichment" . . . . . . . "7111"^^ . "https://api.rohub.org/api/ros/6a656f34-de1f-4d96-9ce2-a93ebd1f1a4c/crate/download/" . . "2022-03-22 02:24:02.954436+00:00" . "2025-03-05 01:19:16.225993+00:00" . "2022-03-22 02:24:02.954436+00:00" . "Bakgrunnsdata for masteroppgaven \"Statistisk prediksjonsmodellering av steinbreer i Norge\" av Harald Wathne Hestad ved Institutt for geofag, Universitetet i Oslo, våren 2021." . "application/ld+json" . . . . . "https://w3id.org/ro-id/6a656f34-de1f-4d96-9ce2-a93ebd1f1a4c" . . "Statistisk prediksjonsmodellering av steinbreer i Norge" . "MANUAL" . "Norway" . "Oslo" . "earth sciences" . "Harald Wathne Hestad" . "Norway" . "Oslo" . "geosciences" . "Bakgrunnsdata for masteroppgaven" . "Institutt for geofag" . "ved Institutt for geofag" . "ved Institutt" . "Bakgrunnsdata for masteroppgaven \"Statistisk prediksjonsmodellering av steinbreer i Norge\" av Harald Wathne Hestad ved Institutt for geofag, Universitetet i Oslo, våren 2021." . "Statistisk prediksjonsmodellering av steinbreer i Norge." . . . . . . "Norway" . "Oslo" . "Harald Wathne Hestad. \"Statistisk prediksjonsmodellering av steinbreer i Norge.\" ROHub. Mar 22 ,2022. https://w3id.org/ro-id/6a656f34-de1f-4d96-9ce2-a93ebd1f1a4c." . "metadata" . . . "biblio" . . . . "data" . . . "raw data" . . . "Hestad, H. W. (2021).Statistisk prediksjonsmodellering av steinbreer i Norge [Data set]. Norstore. https://doi.org/10.11582/2021.00066" . "Harald Wathne Hestad" . "Simulation" . . "https://archive.sigma2.no/pages/public/datasetDetail.jsf?id=10.11582/2021.00066" . . "2021-08-05 00:00:00" . "2022-03-22 02:24:19.675060+00:00" . "Bakgrunnsdata for masteroppgaven \"Statistisk prediksjonsmodellering av steinbreer i Norge\" av Harald Wathne Hestad ved Institutt for geofag, Universitetet i Oslo, våren 2021." . . "Statistisk prediksjonsmodellering av steinbreer i Norge" . "2021-08-05 00:00:00" . . . . "Harald Wathne Hestad" . . . . "Geo H." . . "harald.wathne.hestad@rohub.com" . "Harald Wathne Hestad" . . . "2026-05-19T13:47:42.038+02:00"^^ . . . . . "Statistisk prediksjonsmodellering av steinbreer i Norge" . "RSA" . "MIIBIjANBgkqhkiG9w0BAQEFAAOCAQ8AMIIBCgKCAQEAxszSDYX5tuCSkP7UiCtftYPFNQVTjgNu0I5fwdML2DLRDlp0xzmsQXRk8oHuvwGvG1aMjj6cpUqO+0rz2Sg/wvHOgUpkRH8VJXvmlkhafMLCMtUtk5JIx7e+fkzCby+fnmD7kMkGLrT+OaExWwEDmNlCAt0TPKcHSdwsjso2isXjtAsGevyCMke8ufnFYpjs746JES1eNzVnHnn2Kp/lqcm60GM+J8dLgRZp7fX0anW098xhKym6+xXFzqeju0vYRIHBPerv+r7skWxwk+a7Sd8msqVeYEv6NTqnyWvyWb6Yh8cvj04N6qm/T6C5FUPLQhzSaQgMVMU6yLqjPuu9DwIDAQAB" . "ZPB0ZZJzWXCtpPqZS1emrBDo4tqc1nqw/DqjyNE0N78mN3RwCtCQelqQZf6zhC6VP1lM5+0SRCtIOOFBa92F1W4+ChQ3HtATrc9CPr9FZA9SVn35D9kHDdUt/ppxOw8XIQnEIL6SjUISDfP5mRP1qHEiH2ggaibPMM2FN+8j8M9SSrNdSRytg6sNz5p2PkCznv8S1Wa5tifHHw73uVyJGJjeyTV+7Q+09a2uEh50lIzvKIhwWUAOSxHuKl+YQmUbN7SAoP6sKRbAev99v517Kpfc8Ij69xJ/lWf6TcyYK75xKw4U6kvn0ww+gsHiLTmkZ/KJiKy9YirxV60c2ifg4w==" . . . . . . . "" . "Environmental research" . . "" . "Life sciences" . . "" . "Physical sciences" . . "" . "Biology" . . "in silico antibody-antigen binding database." . . "25.165562913907287" . "22.8" . "The reference publication is available on biorxiv, ID BIORXIV/2021/451258: Robert et al., A billion synthetic 3D-antibody-antigen complexes enable unconstrained machine-learning formalized investigation of antibody specificity prediction" . . "41.16997792494481" . "37.3" . "publication" . . "7.323943661971831" . "5.2" . "antigen" . . "27.605633802816904" . "19.6" . "life sciences" . . "100.0" . "0.6574541926383972" . "antibody" . . "23.253012048192772" . "19.3" . "geochemistry" . . "100.0" . "0.840290367603302" . "software" . . "9.014084507042254" . "6.4" . "51258:" . . "antigen" . . "24.698795180722893" . "20.5" . "forecast" . . "4.457831325301205" . "3.7" . "IT-computer sciences" . . "Science and technology/Technology and engineering/IT-computer sciences" . "publication" . . "6.506024096385542" . "5.4" . "service-account-enrichment" . . . . . . . . . "8927"^^ . "https://api.rohub.org/api/ros/71c90c65-34e6-441e-bb44-d1b31dd1007b/crate/download/" . . "2022-03-22 02:24:21.217126+00:00" . "2025-03-05 00:45:34.790548+00:00" . "2022-03-22 02:24:21.217126+00:00" . "This is a database of in silico generated antibody-antigen bindings (159 antigens times 6.9 million CDRH3 murine sequences), as resource for benchmarking machine learning methods.\n\nThe content of the files is explained in Readme.pdf\n\nThe reference publication is available on biorxiv, ID BIORXIV/2021/451258: Robert et al., A billion synthetic 3D-antibody-antigen complexes enable unconstrained machine-learning formalized investigation of antibody specificity prediction\n\nThe software used to generate the database is available at LINK: http://github.com/csi-greifflab/Absolut for all explanations." . "application/ld+json" . . . . . "https://w3id.org/ro-id/71c90c65-34e6-441e-bb44-d1b31dd1007b" . . "Absolut! in silico antibody-antigen binding database" . "MANUAL" . . . . . . "https://w3id.org/ro-id/b3fb3d46-5fd8-41e7-a090-58181fbb01f1" . "https://w3id.org/ro-id/e0ff8858-262a-485b-a8dd-728c838e8a36" . "https://w3id.org/ro-id/15a39d24-4daa-417e-99ed-4b635b56cae9" . "https://w3id.org/ro-id/4ad66687-f699-45ff-a561-8aea7c629d2a" . "https://w3id.org/ro-id/5195bb19-e10e-4d1d-90e7-b7a591e2af67" . "https://w3id.org/ro-id/6aa13e0d-8332-4955-9f68-5e08e7b97b22" . "https://w3id.org/ro-id/7b70fcab-fd6b-461b-a79b-43cb859348f1" . "https://w3id.org/ro-id/85946983-f823-4c28-88ad-638fd7745f37" . "https://w3id.org/ro-id/89a060f4-22d1-43df-8cca-c29ee9213d21" . "https://w3id.org/ro-id/9d840ee9-e861-4815-ad57-62fc3d3d062b" . "https://w3id.org/ro-id/c1a70a12-6e53-4c98-9b4d-481c69d5a481" . "https://w3id.org/ro-id/c4ebfa3e-5087-4695-abbd-28cb65a0d1e6" . "https://w3id.org/ro-id/49e70145-19cf-4ac3-9da9-fb2b49f5471c" . "https://w3id.org/ro-id/286e5fd8-7d69-4aaf-854e-a0921db660a8" . "https://w3id.org/ro-id/8063038f-6dbd-4148-85a2-afb472b141cd" . "https://w3id.org/ro-id/5782c378-2b05-41eb-b48b-de733932007a" . "https://w3id.org/ro-id/c008e2b7-f43b-4e10-ae2b-e9b7c99d2c24" . "https://w3id.org/ro-id/0ce573ff-277b-4be8-9a5b-6a9c675e96f5" . "https://w3id.org/ro-id/0f6898fa-86e3-42c4-8cff-48968d07dbdf" . "https://w3id.org/ro-id/45689fb7-0f9f-4c04-b03e-13e29ca1b3b7" . "https://w3id.org/ro-id/9021ea62-7039-4cc7-b810-4c89cf540ee5" . "https://w3id.org/ro-id/a164d3a9-ac2e-4c63-b573-2cc2e497ee5e" . "https://w3id.org/ro-id/c6ab0333-3816-48d6-a0c5-f430a5569eff" . "https://w3id.org/ro-id/e912021a-590a-404b-a2e0-3f2335f06f0a" . "https://w3id.org/ro-id/14804972-fa34-4e28-b8d1-7c1a8c800f2e" . "https://w3id.org/ro-id/fec8824a-34e3-4f6c-be08-b0863b0c242a" . "https://w3id.org/ro-id/7247b893-bbcd-47aa-86dd-b27e9f592c25" . "https://w3id.org/ro-id/a1c41d03-c971-45df-bfc6-b023608097a5" . "https://w3id.org/ro-id/c2b8dfdb-c1fc-42e1-841c-7b0e25ca1af3" . "https://w3id.org/ro-id/d1dc98f7-1b59-477f-b20e-5ce10570a46b" . "https://w3id.org/ro-id/fff4fa92-d823-45bd-8cbb-df9573cbb862" . "https://w3id.org/ro-id/011545de-72ea-4477-b87e-e4a0e9c8df4b" . "https://w3id.org/ro-id/092bc252-092d-439d-8551-fada7f4d509e" . "https://w3id.org/ro-id/89a51f68-a057-4f1a-9f39-051fe69eefb6" . "Philippe ROBERT, Victor Greiff, and Rahmad Akbar. \"Absolut! in silico antibody-antigen binding database.\" ROHub. Mar 22 ,2022. https://w3id.org/ro-id/71c90c65-34e6-441e-bb44-d1b31dd1007b." . . "data" . . . "raw data" . . . "metadata" . . . . "biblio" . . . . "https://www.biorxiv.org/content/10.1101/2021.07.06.451258v2" . . "2022-03-22 02:24:46.046298+00:00" . "2022-03-22 02:24:46.241115+00:00" . . "https://www.biorxiv.org/content/10.1101/2021.07.06.451258v2" . "2022-03-22 02:24:46.046298+00:00" . . . . "ROBERT, P., Greiff, V., Akbar, R. (2021).Absolut! in silico antibody-antigen binding database [Data set]. Norstore. https://doi.org/10.11582/2021.00063" . "University of Oslo (UiO)" . "Simulation" . . "https://archive.sigma2.no/pages/public/datasetDetail.jsf?id=10.11582/2021.00063" . . "2021-07-12 00:00:00" . "2022-03-22 02:24:50.074536+00:00" . "This is a database of in silico generated antibody-antigen bindings (159 antigens times 6.9 million CDRH3 murine sequences), as resource for benchmarking machine learning methods.\n\nThe content of the files is explained in Readme.pdf\n\nThe reference publication is available on biorxiv, ID BIORXIV/2021/451258: Robert et al., A billion synthetic 3D-antibody-antigen complexes enable unconstrained machine-learning formalized investigation of antibody specificity prediction\n\nThe software used to generate the database is available at LINK for all explanations." . . "Absolut! in silico antibody-antigen binding database" . "2021-07-12 00:00:00" . . . . "Philippe Paul Auguste Robert" . . . . "unconstrained machine-learning" . . "7.515923566878981" . "5.9" . "database" . . "6.144578313253011" . "5.1" . "earth sciences" . . "100.0" . "0.840290367603302" . "binding" . . "7.590361445783133" . "6.3" . "machine learning" . . "12.891566265060241" . "10.7" . "This is a database of in silico generated antibody-antigen bindings (159 antigens times 6.9 million CDRH3 murine sequences), as resource for benchmarking machine learning methods." . . "33.6644591611479" . "30.5" . "antibody" . . "25.774647887323944" . "18.3" . "complex" . . "5.783132530120482" . "4.8" . "machine learning" . . "14.647887323943662" . "10.4" . "silico antibody-antigen" . . "24.331210191082807" . "19.1" . "biochemistry" . . "50.0" . "12.7" . "Software" . . "Economy, business and finance/Economic sector/Computing and information technology/Software" . "specificity" . . "3.6144578313253013" . "3.0" . "specificity prediction" . . "22.802547770700635" . "17.9" . "investigation" . . "5.0602409638554215" . "4.2" . "binding" . . "8.591549295774648" . "6.1" . "antigens times" . . "7.388535031847134" . "5.8" . "immunology" . . "50.0" . "12.7" . "Robert" . . "7.042253521126761" . "5.0" . "life sciences (general)" . . "100.0" . "0.6574541926383972" . "antibody-antigen binding" . . "37.961783439490446" . "29.8" . "Geo H." . . "philippe.robert@rohub.com" . "Philippe ROBERT" . . "rahmad.akbar@rohub.com" . "Rahmad Akbar" . . "victor.greiff@rohub.com" . "Victor Greiff" . . . "2026-05-19T13:47:41.739+02:00"^^ . . . . . "Absolut! in silico antibody-antigen binding database" . "RSA" . "MIIBIjANBgkqhkiG9w0BAQEFAAOCAQ8AMIIBCgKCAQEAxszSDYX5tuCSkP7UiCtftYPFNQVTjgNu0I5fwdML2DLRDlp0xzmsQXRk8oHuvwGvG1aMjj6cpUqO+0rz2Sg/wvHOgUpkRH8VJXvmlkhafMLCMtUtk5JIx7e+fkzCby+fnmD7kMkGLrT+OaExWwEDmNlCAt0TPKcHSdwsjso2isXjtAsGevyCMke8ufnFYpjs746JES1eNzVnHnn2Kp/lqcm60GM+J8dLgRZp7fX0anW098xhKym6+xXFzqeju0vYRIHBPerv+r7skWxwk+a7Sd8msqVeYEv6NTqnyWvyWb6Yh8cvj04N6qm/T6C5FUPLQhzSaQgMVMU6yLqjPuu9DwIDAQAB" . "sUNDqTjhQEjrU4UeGZ4QIBg1UiGp79PGmyE9Xnmr9JtU4unkeh2/i8a9QVMZR/888/6WH6DNt0PHUZFzTXXGM5MfAg45r2cbBhKQATj33HHnlKdZi13mGTvn1BMBYk25gjCi8+xXvaOdF6x07djK8PqYHLdU+8rfNtDeQF63vvEOX3bILLpVSnKxKiyw1V+kpuZdKfuz6nUZqHwKvxtu+N0J+IgOoVaK+fCmwl8iRId1l7Sf/Px+ljPEP0CyX5LBFrYS8q//MboNrRiXwp4BvuLOwREpM6tKSnMONaWnSPpUtC3ZlwHdMatIYXfZv3uLalJaDrk8+0fJ92u5why8pA==" . . . . . . . "" . "Environmental research" . . "" . "Life sciences" . . "" . "Physical sciences" . . "" . "Earth sciences" . . "service-account-enrichment" . . . . . . . "7096"^^ . "https://api.rohub.org/api/ros/063f3c98-2306-4388-86b2-4b09976fc16d/crate/download/" . . "2022-03-22 02:24:51.576414+00:00" . "2025-03-05 00:52:20.015916+00:00" . "2022-03-22 02:24:51.576414+00:00" . "Accumulated preciptiation, 15 min temporal resolution, 3km spatial resolution. Year 1985 to 2005. Covering the inner most part of Oslofjorden in Norway." . "application/ld+json" . . . . . "https://w3id.org/ro-id/063f3c98-2306-4388-86b2-4b09976fc16d" . . "HARMONIE-AROME precipitation" . "MANUAL" . "Norway" . "precipitation" . "earth sciences" . "Executive (government)" . "Medicine" . "Ministers (government)" . "Weather" . "HARMONIE-AROME" . "Norway" . "Oslofjorden" . "precipitation" . "general" . "HARMONIE-AROME precipitation" . "part of Oslofjorden" . "Covering the inner most part of Oslofjorden in Norway." . "HARMONIE-AROME precipitation." . "Year 1985 to 2005." . "15 min" . "Year 1985 to 2005" . . . . . . "Norway" . "Eirik Nordgård. \"HARMONIE-AROME precipitation.\" ROHub. Mar 22 ,2022. https://w3id.org/ro-id/063f3c98-2306-4388-86b2-4b09976fc16d." . "biblio" . . . "metadata" . . . . "data" . . . "raw data" . . . "Nordgård, E., Nordgård, E. (2021).HARMONIE-AROME precipitation [Data set]. Norstore. https://doi.org/10.11582/2021.00058" . "Eirik Nordgård" . "Simulation" . . "https://archive.sigma2.no/pages/public/datasetDetail.jsf?id=10.11582/2021.00058" . . "2021-06-21 00:00:00" . "2022-03-22 02:25:09.852200+00:00" . "Accumulated preciptiation, 15 min temporal resolution, 3km spatial resolution. Year 1985 to 2005. Covering the inner most part of Oslofjorden in Norway." . . "HARMONIE-AROME precipitation" . "2021-06-21 00:00:00" . . . . "Eirik Nordgård" . . . . "eirik.nordgard@rohub.com" . "Eirik Nordgård" . . "Geo H." . . . "2026-05-19T13:47:41.440+02:00"^^ . . . . . "HARMONIE-AROME precipitation" . "RSA" . "MIIBIjANBgkqhkiG9w0BAQEFAAOCAQ8AMIIBCgKCAQEAxszSDYX5tuCSkP7UiCtftYPFNQVTjgNu0I5fwdML2DLRDlp0xzmsQXRk8oHuvwGvG1aMjj6cpUqO+0rz2Sg/wvHOgUpkRH8VJXvmlkhafMLCMtUtk5JIx7e+fkzCby+fnmD7kMkGLrT+OaExWwEDmNlCAt0TPKcHSdwsjso2isXjtAsGevyCMke8ufnFYpjs746JES1eNzVnHnn2Kp/lqcm60GM+J8dLgRZp7fX0anW098xhKym6+xXFzqeju0vYRIHBPerv+r7skWxwk+a7Sd8msqVeYEv6NTqnyWvyWb6Yh8cvj04N6qm/T6C5FUPLQhzSaQgMVMU6yLqjPuu9DwIDAQAB" . "Ykdbe33ypHua104VZMlyz9XMpZ3ObI3GpvLLppUFjHtK63Vc1UEQ/g1Dq9a4oN2HHSJ3/3MYjs2IzETL2tShnWoaX3529snY9MTtUkuvZcdHNdsztMSoKY5a5f/RAmTBft9pfQHLF5C+vj5IhplFMs4dJde5Z3y5isXAQLI0ThHVt0CLqgqF7VeQlQ/fCHTQvDENs54eJ5kgZhDXVMQGJroNDJNz/LOeSBPFfrmbp4uVP0I4oJCyhYPYhklwxMrHcMe2pmzLn/i05+EjyuZfyTXkvp+N7f/GLk3XYAWvkBxktX4JgjbNbAtL/xZTpF9wOm8gIQiQ4+gzZCK4uEwMUQ==" . . . . . . . "Elisa Trasatti; Stefano Sal" . . . "http://w3id.org/ro-id/rohub/model#change_specifications/a41f86bc-d941-490c-bd77-0d346847de48/changes/07defd9e-e852-4b3b-bd53-d8804eabf75c" . "http://w3id.org/ro-id/rohub/model#change_specifications/a41f86bc-d941-490c-bd77-0d346847de48/changes/51cc4efc-08f0-4f07-9e5f-adf0d894c4af" . . "http://indico.ictp.it/event/a08176/session/82/contribution/62/material/0/0.pdf" . . . "http://indico.ictp.it/event/a08176/session/82/contribution/62/material/0/0.pdf" . . . . "deformation model" . . "United Kingdom" . "University of Leeds" . . . "Fortran code" . . "seismic hazard" . "University of LeedsU.K." . . . "Fortran" . . "Mogi model" . "Tim Wright" . . . "computer programming" . . "computer code" . . "volcanology" . . "models" . . "volcano deformation model" . . "system" . "Elisa Trasatti" . . "service-account-enrichment" . . . "http://sandbox.rohub.org/rodl/ROs/Mogi_model/" . "2021-05-11T11:11:04.115+02:00" . "https://plus.google.com/103457129851450819242" . "http://w3id.org/ro-id/rohub/model#change_specifications/a41f86bc-d941-490c-bd77-0d346847de48" . . "6343"^^ . "https://api.rohub.org/api/ros/4cc2cb8d-4ace-4fd2-8ea4-674ac0514f76/crate/download/" . . "2021-05-11 09:11:04.115000+00:00" . "2025-03-05 00:56:57.842643+00:00" . "2021-05-11 09:11:04.115000+00:00" . "This is the Mogi (1958) model. Fortran code." . "application/ld+json" . . . "https://w3id.org/ro-id/4cc2cb8d-4ace-4fd2-8ea4-674ac0514f76" . . "Mogi model (1958)" . . . . . . "https://w3id.org/ro-id/4cc2cb8d-4ace-4fd2-8ea4-674ac0514f76" . "Elisa Trasatti; Stefano Sal. \"Mogi model (1958).\" ROHub. May 11 ,2021. https://w3id.org/ro-id/4cc2cb8d-4ace-4fd2-8ea4-674ac0514f76." . . "Biblio" . . . . "tool" . . . . "http://indico.ictp.it/event/a08176/session/82/contribution/62/material/0/0.pdf" . . "2022-03-24 13:14:05.984220+00:00" . "2022-03-24 13:14:09.157706+00:00" . "application/pdf" . . "presentation of the model" . "2022-03-24 13:14:05.984220+00:00" . . . . . "1104"^^ . "https://api.rohub.org/api/resources/a6fe3471-3b69-4508-a607-0851897d612a/download/" . . "2021-05-11 09:05:12.945000+00:00" . "2022-03-24 13:14:08.904850+00:00" . . "mogi.f" . "2021-05-11 09:05:12.945000+00:00" . . . . . . . "service-account-generation-service" . . . "2026-05-19T13:47:31.932+02:00"^^ . . . . . "Mogi model (1958)" . "RSA" . "MIIBIjANBgkqhkiG9w0BAQEFAAOCAQ8AMIIBCgKCAQEAxszSDYX5tuCSkP7UiCtftYPFNQVTjgNu0I5fwdML2DLRDlp0xzmsQXRk8oHuvwGvG1aMjj6cpUqO+0rz2Sg/wvHOgUpkRH8VJXvmlkhafMLCMtUtk5JIx7e+fkzCby+fnmD7kMkGLrT+OaExWwEDmNlCAt0TPKcHSdwsjso2isXjtAsGevyCMke8ufnFYpjs746JES1eNzVnHnn2Kp/lqcm60GM+J8dLgRZp7fX0anW098xhKym6+xXFzqeju0vYRIHBPerv+r7skWxwk+a7Sd8msqVeYEv6NTqnyWvyWb6Yh8cvj04N6qm/T6C5FUPLQhzSaQgMVMU6yLqjPuu9DwIDAQAB" . "Fbi2bzm2vg9hOsvEOtV8eBbXgjf7+X8ThjaIjE6rErLf7xZxoAbWLz7pRkUoRE8a7c6vMNRG2SlHwnpOX+KLpsVyTcMA0K4FHELdVMFEqonyqlEJ19OD+XjPYB3r1gbNw9cRs0GayoaDbRgaPfXxfSSTDx6JrD+lX2FRSVVUccXZXFvVb2X9RmwkFIuVfzze6nrAMQrQHX75rP4aP41YisguQqYcl5rgQIuZS7Zsjct4zc22Kku8kN+heBVtS5hN8MpD7Tcr1sJgDdy7j8EVvTi6Rfk7PvvERKSarnF96yJv0gzDlF6HbBL6soK/nC+awh2DgVe/Y8FTixJqeS8Tgw==" . . . . . . . "Elisa Trasatti; Stefano Sal" . . "https://w3id.org/ro-id/1a03b374-b9cd-467b-a8b8-39c5a31a2624" . "2021-05-11T11:11:04.115+02:00" . "https://plus.google.com/103457129851450819242" . . "http://sandbox.rohub.org/rodl/ROs/Mogi_model-fork/" . . . "deformation model" . . "United Kingdom" . "University of Leeds" . . . "Fortran code" . . "seismic hazard" . "University of LeedsU.K." . . . "Fortran" . . "Mogi model" . "Tim Wright" . . . "computer programming" . . "computer code" . . "volcanology" . . "models" . . "volcano deformation model" . . "system" . "Elisa Trasatti" . . "Elisa Trasatti" . . . "service-account-enrichment" . . . "http://sandbox.rohub.org/rodl/ROs/Mogi_model-snapshot/" . . "202373"^^ . "https://api.rohub.org/api/ros/1a03b374-b9cd-467b-a8b8-39c5a31a2624/crate/download/" . . "https://orcid.org/0000-0002-2983-045X" . . "2021-05-11 08:47:47.797000+00:00" . "2025-03-05 00:56:58.032094+00:00" . "2021-05-11 08:47:47.797000+00:00" . "This is the Mogi (1958) model. Fortran code." . "application/ld+json" . . . . "https://w3id.org/ro-id/1a03b374-b9cd-467b-a8b8-39c5a31a2624" . "volcanoes, model, isotropic source, mogi" . . "Mogi model (1958)" . . . . . . "Trasatti, Elisa, and Elisa Trasatti. \"Mogi model (1958).\" ROHub. May 11 ,2021. https://w3id.org/ro-id/1a03b374-b9cd-467b-a8b8-39c5a31a2624." . . "Biblio" . . . . "tool" . . . . "1104"^^ . "https://api.rohub.org/api/resources/033b8c11-3a5f-4f84-8c67-1868dddd65ab/download/" . . "2021-05-11 09:05:12.945000+00:00" . "2022-03-24 13:14:30.663106+00:00" . . "mogi.f" . "2021-05-11 09:05:12.945000+00:00" . . . . . "http://indico.ictp.it/event/a08176/session/82/contribution/62/material/0/0.pdf" . . "2021-05-11 08:47:47.797000+00:00" . "2022-03-24 13:14:29.572171+00:00" . "application/pdf" . . "presentation of the model" . "2021-05-11 08:47:47.797000+00:00" . . . . . "279102"^^ . "https://api.rohub.org/api/resources/db406fa3-53da-40a8-8a8a-03158c27ff56/download/" . . "2021-05-11 09:13:42.221000+00:00" . "2022-03-24 13:14:31.624390+00:00" . "image/jpeg" . . "galland-epsl-2012-figura-2.jpg" . "2021-05-11 09:13:42.221000+00:00" . . . . . . . "service-account-generation-service" . . . "2026-05-19T13:47:31.682+02:00"^^ . . . . . "Mogi model (1958)" . "RSA" . "MIIBIjANBgkqhkiG9w0BAQEFAAOCAQ8AMIIBCgKCAQEAxszSDYX5tuCSkP7UiCtftYPFNQVTjgNu0I5fwdML2DLRDlp0xzmsQXRk8oHuvwGvG1aMjj6cpUqO+0rz2Sg/wvHOgUpkRH8VJXvmlkhafMLCMtUtk5JIx7e+fkzCby+fnmD7kMkGLrT+OaExWwEDmNlCAt0TPKcHSdwsjso2isXjtAsGevyCMke8ufnFYpjs746JES1eNzVnHnn2Kp/lqcm60GM+J8dLgRZp7fX0anW098xhKym6+xXFzqeju0vYRIHBPerv+r7skWxwk+a7Sd8msqVeYEv6NTqnyWvyWb6Yh8cvj04N6qm/T6C5FUPLQhzSaQgMVMU6yLqjPuu9DwIDAQAB" . "EvE05uvJFyJ9IOhUShPEag0ZXzBdMXxdjD9hco1uoOVan9pQCIJQY3hefGiPCQWyMuY9GHD3F5/E4Qgr4aPwbKC8yoOMeb0yZAhzB8AYYK5uYQRuUbz4bQs7x2SvX/c7KJQbhT1Vt8HZnUgc3/97MjvbzetqZVTtD9H6tw1kvJ/BTIfDKKwfwHNPmQyGBjYNtwCPS15k2krhFiHhlyKeFtzzyX1500zwKr4ka4EPO4vFGkbIFylzJeybzmGoTrYZ4Zu/p+C5VUdLUJMZAul5Iin/dXdpve4vs6BRjHm9Iib/iMKFXY4KzACmH0BYzO+dmkZ8xZADVkVU9iXzPZpOaw==" . . . . . . . . "material data" . . "benthic habitat map" . . "hydrography" . . "workflow" . . "material" . . "results" . . "Italy" . "Mariacristina PRAMPOLINI" . . . . . "Adriatic Sea" . . "12.990527740189444" . "9.6" . "Italy" . . "11.785714285714286" . "9.9" . "data" . . "13.802435723951282" . "10.2" . "dataset" . . "8.928571428571429" . "7.5" . "IT-computer sciences" . . "Science and technology/Technology and engineering/IT-computer sciences" . "hydrography" . . "35.820895522388064" . "2.4" . "habitat" . . "13.69047619047619" . "11.5" . "Adriatic Sea" . . "https://www.wikidata.org/wiki/Q13924" . "earth sciences" . . "100.0" . "0.9174467921257019" . "RSOBIA analysis" . . "17.057569296375267" . "16.0" . "map" . . "11.19047619047619" . "9.4" . "geosciences" . . "100.0" . "0.9408681392669678" . "Southern Adriatic Sea CNR-ISMAR" . . "14.073071718538564" . "10.4" . "Adriatic Sea" . . "11.30952380952381" . "9.5" . "Substrate and benthic habitat map of the southern Adriatic Sea (Italy) using RSOBIA - Supplementary material." . . "48.748748748748746" . "48.7" . "job market" . . "64.17910447761194" . "4.3" . "habitat map" . . "45.3091684434968" . "42.5" . "information" . . "12.5" . "10.5" . "material" . . "7.142857142857143" . "6.0" . "workflow" . . "15.714285714285714" . "13.2" . "supplementary material" . . "7.249466950959489" . "6.8" . "service-account-enrichment" . . . "Paper supplementary material" . . "52301134"^^ . "https://api.rohub.org/api/ros/a21484de-74d2-4fd0-9518-d3faa42130ad/crate/download/" . . . . "2021-04-29 14:17:24.578000+00:00" . "2025-03-05 01:23:33.856799+00:00" . "2021-04-29 14:17:24.578000+00:00" . "Data, workflow and results of the RSOBIA analysis carried out on the Southern Adriatic Sea CNR-ISMAR datasets" . "application/ld+json" . . . . . . . . "https://w3id.org/ro-id/a21484de-74d2-4fd0-9518-d3faa42130ad" . "classification" . "cnr-ismar" . "rsobia" . "seafloor map" . "south adriatic sea" . . "Substrate and benthic habitat map of the southern Adriatic Sea (Italy) using RSOBIA - Supplementary material" . . . . "https://w3id.org/ro-id/0f56917f-89a6-49e0-b74e-4721b39ab6ab" . "https://w3id.org/ro-id/57eaad62-13bf-42c3-98dc-89930f63b144" . "https://w3id.org/ro-id/167cd9a8-64c4-49ba-83f2-f8b4f37a4f5b" . "https://w3id.org/ro-id/b0e9c5ef-aa89-4e22-9969-484f1d3935de" . "https://w3id.org/ro-id/038c37fc-f633-43ab-b91e-814df615b163" . "https://w3id.org/ro-id/0717885d-1341-4ec5-b405-17568b0b8c09" . "https://w3id.org/ro-id/1131d28e-5777-4754-b8ff-fae6f2162044" . "https://w3id.org/ro-id/269c9763-3216-404c-b19f-28b5cdb3021d" . "https://w3id.org/ro-id/480375e0-ce99-4a3c-9451-39dcf3fab588" . "https://w3id.org/ro-id/742934b0-41d9-43d4-bab4-812630f76885" . "https://w3id.org/ro-id/7cb26031-0ece-42c2-85bd-5efde7c66cbe" . "https://w3id.org/ro-id/81d93820-e04f-431b-a241-89ce079eb767" . "https://w3id.org/ro-id/b3fc971b-70c3-44f8-85d0-57bd021abe6c" . "https://w3id.org/ro-id/19235d32-e494-4dc2-bb59-4158bbfaa820" . "https://w3id.org/ro-id/f0cfb04e-b4fe-4b71-bb2c-2f4e732d0d9b" . "https://w3id.org/ro-id/0a240d58-d17d-4ac0-8ad0-157f55775d5f" . "https://w3id.org/ro-id/01313f54-7dcd-4e6a-b889-5540148df8b0" . "https://w3id.org/ro-id/048b7846-0bcd-449e-a128-4c7f37037ad0" . "https://w3id.org/ro-id/44f4ae2d-b271-49c5-bcf1-69ea2013e41f" . "https://w3id.org/ro-id/ca7f3f46-1151-4085-b00b-926ab6c5757b" . "https://w3id.org/ro-id/eabb6159-7b16-450d-a6f5-3805400d54af" . "https://w3id.org/ro-id/f88b2cb6-1be8-40c3-a602-e8e3cd7d8b15" . "https://w3id.org/ro-id/fb207d76-e5a5-44db-b5c5-201481e471d7" . "https://w3id.org/ro-id/3048115c-48a6-4e1f-8717-0e4602e40366" . "https://w3id.org/ro-id/e8ca07f4-0e17-403c-9313-39b2a042b63d" . "https://w3id.org/ro-id/20643c5d-d46c-4618-b2cb-7deb90d9fc72" . "https://w3id.org/ro-id/60ec083d-7aa7-400e-8f44-0612b10877de" . "https://w3id.org/ro-id/8c078dad-54e7-450f-99af-4ad758980b42" . "https://w3id.org/ro-id/c9469245-f3db-4904-bd03-74b9ba6575ca" . "https://w3id.org/ro-id/d0404f70-00a1-44e9-b589-ce4c615760e7" . "https://w3id.org/ro-id/4bd9a70d-6536-441a-a7c9-b4dce10aad43" . "https://w3id.org/ro-id/d6dd5213-b29f-4388-a307-d7db7620f6b7" . "Mariacristina PRAMPOLINI, Mariacristina PRAMPOLINI, and Valentina Grande. \"Substrate and benthic habitat map of the southern Adriatic Sea (Italy) using RSOBIA - Supplementary material.\" ROHub. Apr 29 ,2021. https://w3id.org/ro-id/a21484de-74d2-4fd0-9518-d3faa42130ad." . . . . . . . . . . . . . . "Backscatter" . . . . . . . . . . . . . . . "Bathymetry" . . . . . . "Input_data" . . . . "Workflow" . . . . "Results" . . . . "http://libeccio.bo.ismar.cnr.it:8080/geonetwork/srv/eng/catalog.search#/metadata/144be6fc-af99-4ec1-ae06-67e576928f8e" . . "2021-04-29 14:17:24.578000+00:00" . "2022-03-24 13:16:58.359642+00:00" . . "Bathymetry MAGIC0409" . "2021-04-29 14:17:24.578000+00:00" . . . . . "http://libeccio.bo.ismar.cnr.it:8080/geonetwork/srv/ita/catalog.search#/metadata/76516bee-05e1-43b1-8f28-67d2aa26f9d0" . . "2021-04-29 14:17:24.578000+00:00" . "2022-03-24 13:16:56.812624+00:00" . . "Backscatter ARCADIA" . "2021-04-29 14:17:24.578000+00:00" . . . . . "http://libeccio.bo.ismar.cnr.it:8080/geonetwork/srv/ita/catalog.search#/metadata/fa1e20e6-219a-4124-a5bc-2948a28cbb7c" . . "2021-04-29 14:17:24.578000+00:00" . "2022-03-24 13:16:56.370373+00:00" . . "Backscatter MEMA12" . "2021-04-29 14:17:24.578000+00:00" . . . . . "http://libeccio.bo.ismar.cnr.it:8080/geonetwork/srv/ita/catalog.search#/metadata/4348d806-9658-40e7-b14e-94b90e0dd537" . . "2021-04-29 14:17:24.578000+00:00" . "2022-03-24 13:16:57.232467+00:00" . . "Bathymetry MEMA12" . "2021-04-29 14:17:24.578000+00:00" . . . . . "http://libeccio.bo.ismar.cnr.it:8080/geonetwork/srv/eng/catalog.search#/metadata/dcab0978-d86c-46e0-8600-d6e3351583d9" . . "2021-04-29 14:17:24.578000+00:00" . "2022-03-24 13:16:58.513017+00:00" . . "Bathymetry ALTRO" . "2021-04-29 14:17:24.578000+00:00" . . . . . "http://libeccio.bo.ismar.cnr.it:8080/geonetwork/srv/eng/catalog.search#/metadata/daa62bbb-7bbc-4fb7-9b6a-e09355292532" . . "2021-04-29 14:17:24.578000+00:00" . "2022-03-24 13:16:58.216770+00:00" . . "Bathymetry MAGIC0910" . "2021-04-29 14:17:24.578000+00:00" . . . . . "http://libeccio.bo.ismar.cnr.it:8080/geonetwork/srv/eng/catalog.search#/metadata/9acb93d8-b520-42cc-8663-ea37390b7cb2" . . "2021-04-29 14:17:24.578000+00:00" . "2022-03-24 13:16:57.940864+00:00" . . "Bathymetry ARCADIA" . "2021-04-29 14:17:24.578000+00:00" . . . . . "http://libeccio.bo.ismar.cnr.it:8080/geonetwork/srv/eng/catalog.search#/metadata/41073552-bec2-45d4-8735-ab066908fdc9" . . "2021-04-29 14:17:24.578000+00:00" . "2022-03-24 13:16:58.073162+00:00" . . "Bathymetry MAGIC0709-ADRIA" . "2021-04-29 14:17:24.578000+00:00" . . . . . "1433"^^ . "https://api.rohub.org/api/resources/49fedaac-e090-4cd1-8709-f0e7cc314b22/download/" . . "2021-05-04 13:01:48.522000+00:00" . "2022-03-24 13:17:09.986181+00:00" . "A huge amount of multibeam backscatter data has been acquired from the east to the west side of thein the southern Adriatic Sea in the last 15 years and coveringby CNR –ISMAR. from the continental shelf down to the basin floor, from the west to east side of the Adriatic Basin. These data have been used for geological, biological and habitat mapping purposes, but a single and consistent interpretation of all the acquired backscatter data has never been carried out. Here, we aimed at coherently interpreting the seafloor reflectivity datasets in order to produce aseabed and benthic habitat maps of the southern Adriatic Sea showing the spatial distribution of substrate and sediment type and grain size within the basin. The methodology here applied consists of a semi-automated classification of backscatter images through object-based image analysis (OBIA) performed through the ArcGIS tool RSOBIA (Remote Sensing OBIA). This unsupervised image segmentation was carried out on each backscatter dataset separately and then validated through comparison with bottom samples and images acquired during the different oceanographic cruises. The substrate was then classified following the a classification scheme proposed within the CoCoNet specifically elaborated in-house project. The results were described and discussed as well as the methodology applied and the significance of the backscatter data in general." . "text/plain" . . "Abstract of the scientific paper" . "2021-05-04 13:01:48.522000+00:00" . . . . . "57493288"^^ . "https://api.rohub.org/api/resources/51d0e2aa-38ce-462d-ae38-148baa2ddd52/download/" . . "2021-05-04 12:58:45.722000+00:00" . "2022-03-24 13:17:01.157003+00:00" . "http://libeccio.bo.ismar.cnr.it:8080/geonetwork/srv/ita/catalog.search#/metadata/a99af2f9-a4d5-4c57-9477-b01935bed0e8" . "application/pdf" . . "RSOBIA_map_30.04.2021.pdf" . "2021-05-04 12:58:45.722000+00:00" . . . . "https://www.mdpi.com/2072-4292/13/15/2913" . . "201216"^^ . "https://api.rohub.org/api/resources/588e8076-6ffb-40fb-ae05-7f43a8e8153a/download/" . . "2021-05-04 12:14:22.858000+00:00" . "2022-03-24 13:16:55.387554+00:00" . "The workflow consits of three steps: 1. RSOBIA segmentation Segmentation is a method to aggregate pixels together to create a thematic map. The segmentation process is a licensed tool taking a multi-layered image and creates a set of polygons defined by the statistics associated with the layered image. Clusters of the imagery pixels are created in n-dimensional space and created into classes. Aggregation into geographic regions (polygons) is done according to a minimum polygon size rule, and clustering rules. Input is a single multi-layered file – not a geodatabase. Output is a single polygon vector shapefile and its default filename is the same as the input basename but with a different filetype. 2.Add Segment Attributes Following segmentation, the attributes for each polygon only relate to the polygon shape and class. It is often required to view and use the values of initial raster layers. These can be aggregated for each polygon as an attribute value of the mean and standard deviation of the pixel values within the polygon for each layer. 3. GroundTruth Samples The attributes for each polygon can be extended if groundtruth point data is available. This is a very simple join of two datasets and effectively adds the attributes of a groundtruth data point to the relevant polygon. In this way the samples may be utilised to characterise the class type. Some polygons may not have groundtruth samples and will therefore be left blank. Hopefully enough of the polygons will have groundtruth points to inform the class descriptions." . . "Arc Toolbox - Prampolini et al. 2021" . "2021-05-04 12:14:22.858000+00:00" . "ArcGIS 10.1-10.5" . . . . "https://w3id.org/ro-id/a21484de-74d2-4fd0-9518-d3faa42130ad/RSOBIA_WF.JPG" . . "http://libeccio.bo.ismar.cnr.it:8080/geonetwork/srv/eng/catalog.search#/metadata/b2e5125f-9737-4371-ac8c-852379dee2aa" . . "2021-04-29 14:17:24.578000+00:00" . "2022-03-24 13:16:57.658822+00:00" . . "Bathymetry COCOMAP13" . "2021-04-29 14:17:24.578000+00:00" . . . . . "http://libeccio.bo.ismar.cnr.it:8080/geonetwork/srv/ita/catalog.search#/metadata/61b97f61-c059-42e0-b251-92f560a740b4" . . "2021-04-29 14:17:24.578000+00:00" . "2022-03-24 13:16:56.659787+00:00" . . "Backscatter ALTRO" . "2021-04-29 14:17:24.578000+00:00" . . . . . "http://libeccio.bo.ismar.cnr.it:8080/geonetwork/srv/ita/catalog.search#/metadata/f36ab0c1-ce7c-480c-b677-8299cc3cb023" . . "2021-04-29 14:17:24.578000+00:00" . "2022-03-24 13:16:56.507037+00:00" . . "Backscatter MAGIC0211" . "2021-04-29 14:17:24.578000+00:00" . . . . . "http://libeccio.bo.ismar.cnr.it:8080/geonetwork/srv/eng/catalog.search#/metadata/4ee520c1-e5ee-475f-acb9-29707e68561a" . . "2021-04-29 14:17:24.578000+00:00" . "2022-03-24 13:16:57.804850+00:00" . . "Bathymetry COCOMAP14" . "2021-04-29 14:17:24.578000+00:00" . . . . . "http://libeccio.bo.ismar.cnr.it:8080/geonetwork/srv/ita/catalog.search#/metadata/da33524a-f985-4e4b-a287-030d5cc14968" . . "2021-04-29 14:17:24.578000+00:00" . "2022-03-24 13:16:57.087312+00:00" . . "Bathymetry SAGA-03" . "2021-04-29 14:17:24.578000+00:00" . . . . . "http://libeccio.bo.ismar.cnr.it:8080/geonetwork/srv/ita/catalog.search#/metadata/0fa7c323-276e-461b-8269-bbd42fc98219" . . "2021-04-29 14:17:24.578000+00:00" . "2022-03-24 13:16:57.363622+00:00" . . "Bathymetry OBAMA" . "2021-04-29 14:17:24.578000+00:00" . . . . . "http://libeccio.bo.ismar.cnr.it:8080/geonetwork/srv/ita/catalog.search#/metadata/43dacd1e-433a-4376-aad8-eccbcf9725a5" . . "2021-04-29 14:17:24.578000+00:00" . "2022-03-24 13:16:55.939095+00:00" . . "Backscatter COCOMAP14" . "2021-04-29 14:17:24.578000+00:00" . . . . . "http://libeccio.bo.ismar.cnr.it:8080/geonetwork/srv/ita/catalog.search#/metadata/c6970d73-2192-48ce-b273-85f24cb859fb" . . "2021-04-29 14:17:24.578000+00:00" . "2022-03-24 13:16:52.030015+00:00" . "TOBI side scan sonar image" . . "Side scan sonar SAGA03" . "2021-04-29 14:17:24.578000+00:00" . . . . . "3186458"^^ . "https://api.rohub.org/api/resources/ae5ce1a9-47b9-4d4d-967c-ca80f4274eb7/download/" . . "2021-05-31 13:49:48.700000+00:00" . "2022-03-24 13:17:03.336757+00:00" . "Result of the paper" . "image/jpeg" . . "Substrate and benthic hanitat map of the sourthern Adriatic Sea" . "2021-05-31 13:49:48.700000+00:00" . . . . . "http://libeccio.bo.ismar.cnr.it:8080/geonetwork/srv/ita/catalog.search#/metadata/37732044-52bf-49f7-bcdd-2cf70012372e" . . "2021-04-29 14:17:24.578000+00:00" . "2022-03-24 13:16:56.958674+00:00" . . "Backscatter COCOMAP13" . "2021-04-29 14:17:24.578000+00:00" . . . . . "http://libeccio.bo.ismar.cnr.it:8080/geonetwork/srv/ita/catalog.search#/metadata/0571ed5c-eb2b-471f-b974-69b788a1aecc" . . "2021-04-29 14:17:24.578000+00:00" . "2022-03-24 13:16:55.616892+00:00" . . "Backscatter MAGIC0409" . "2021-04-29 14:17:24.578000+00:00" . . . . . "http://libeccio.bo.ismar.cnr.it:8080/geonetwork/srv/ita/catalog.search#/metadata/31884c40-2f2b-4452-a060-59c3a2ab645f" . . "2021-04-29 14:17:24.578000+00:00" . "2022-03-24 13:16:56.080163+00:00" . . "Backscatter OBAMA" . "2021-04-29 14:17:24.578000+00:00" . . . . . "http://libeccio.bo.ismar.cnr.it:8080/geonetwork/srv/ita/catalog.search#/metadata/3c202e6b-bbde-4761-8537-941fd0feb6fb" . . "2021-04-29 14:17:24.578000+00:00" . "2022-03-24 13:16:56.225023+00:00" . . "Backscatter MAGIC0709" . "2021-04-29 14:17:24.578000+00:00" . . . . . "545334"^^ . "https://api.rohub.org/api/resources/d6f030ec-71ee-424e-a7f9-f306b32945d0/download/" . . "2021-08-27 09:12:01.708000+00:00" . "2022-03-24 13:17:07.765085+00:00" . "Workflow applied in the present work visualized in Model Builder (ArcGIS 10.5) and showing the tools of RSOBIA toolset used in the present work (yellow), the input data - rasters to be seg-mented and ground-truthing data – (purple), the segmentation parameters to be chosen by the operator (light blue), the results (green) and the ArcGIS workspace (dark blue)" . "image/jpeg" . . "Image of the workflow in model builder" . "2021-08-27 09:12:01.708000+00:00" . . . . . "1306366"^^ . "https://api.rohub.org/api/resources/da5ca13c-7abe-4245-8bc4-d3215e52791a/download/" . . "2021-05-31 13:53:02.389000+00:00" . "2022-03-24 13:17:04.989241+00:00" . "image/jpeg" . . "Samples used to classify substrates and benthic habitats" . "2021-05-31 13:53:02.389000+00:00" . . . . . "https://www.mdpi.com/2072-4292/13/15/2913" . . "2021-04-29 14:17:24.578000+00:00" . "2022-03-24 13:17:07.985558+00:00" . "Prampolini, M.; Angeletti, L.; Castellan, G.; Grande, V.; Le Bas, T.; Taviani, M.; Foglini, F. Benthic Habitat Map of the Southern Adriatic Sea (Mediterranean Sea) from Object-Based Image Analysis of Multi-Source Acoustic Backscatter Data. Remote Sens. 2021, 13, 2913. https://doi.org/10.3390/rs13152913" . . "Scientific paper" . "2021-04-29 14:17:24.578000+00:00" . . . . . "http://libeccio.bo.ismar.cnr.it:8080/geonetwork/srv/ita/catalog.search#/metadata/31aea371-7e29-42c2-883a-ab580fd0d3d9" . . "2021-04-29 14:17:24.578000+00:00" . "2022-03-24 13:16:55.801602+00:00" . . "Backscatter MAGIC040910" . "2021-04-29 14:17:24.578000+00:00" . . . . . "http://libeccio.bo.ismar.cnr.it:8080/geonetwork/srv/eng/catalog.search#/metadata/bddc9e61-07f8-4c69-bc98-33d54ed3daf2" . . "2021-04-29 14:17:24.578000+00:00" . "2022-03-24 13:16:57.516122+00:00" . . "Bathymetry MAGIC0211" . "2021-04-29 14:17:24.578000+00:00" . . . . . "http://libeccio.bo.ismar.cnr.it:8080/geonetwork/srv/eng/catalog.search#/metadata/d07a74a7-e953-457f-9e6c-0d0a27b8ab69" . . "2021-04-29 14:17:24.578000+00:00" . "2022-03-24 13:16:58.294604+00:00" . . "Bathymetry MS15" . "2021-04-29 14:17:24.578000+00:00" . . . . . "http://libeccio.bo.ismar.cnr.it:8080/geonetwork/srv/ita/catalog.search#/metadata/54fa2a6d-25e8-4135-982c-1713674d7d70" . . "2021-04-29 14:17:24.578000+00:00" . "2022-03-24 13:16:51.953806+00:00" . "Backscatter acquired with Reson Seabat 7160" . . "Backscatter MSFD15" . "2021-04-29 14:17:24.578000+00:00" . . . . . . . "Italy" . . "https://www.wikidata.org/wiki/Q38" . "testing" . . "7.738095238095238" . "6.5" . "map of the southern Adriatic Sea" . . "11.087420042643924" . "10.4" . "Italy" . . "12.990527740189444" . "9.6" . "Southern Adriatic Sea CNR-ISMAR dataset" . . "19.296375266524525" . "18.1" . "Data, workflow and results of the RSOBIA analysis carried out on the Southern Adriatic Sea CNR-ISMAR datasets" . . "51.25125125125125" . "51.2" . "geophysics" . . "100.0" . "0.9408681392669678" . "habitat" . . "15.155615696887685" . "11.2" . "oceanography" . . "100.0" . "0.9174467921257019" . "map" . . "12.719891745602164" . "9.4" . "workflow" . . "18.267929634641405" . "13.5" . "service-account-generation-service" . . . "2026-05-19T13:47:31.320+02:00"^^ . . . . . "Substrate and benthic habitat map of the southern Adriatic Sea (Italy) using RSOBIA - Supplementary material" . "RSA" . "MIIBIjANBgkqhkiG9w0BAQEFAAOCAQ8AMIIBCgKCAQEAxszSDYX5tuCSkP7UiCtftYPFNQVTjgNu0I5fwdML2DLRDlp0xzmsQXRk8oHuvwGvG1aMjj6cpUqO+0rz2Sg/wvHOgUpkRH8VJXvmlkhafMLCMtUtk5JIx7e+fkzCby+fnmD7kMkGLrT+OaExWwEDmNlCAt0TPKcHSdwsjso2isXjtAsGevyCMke8ufnFYpjs746JES1eNzVnHnn2Kp/lqcm60GM+J8dLgRZp7fX0anW098xhKym6+xXFzqeju0vYRIHBPerv+r7skWxwk+a7Sd8msqVeYEv6NTqnyWvyWb6Yh8cvj04N6qm/T6C5FUPLQhzSaQgMVMU6yLqjPuu9DwIDAQAB" . "DZQz0ITA4uXbqhwTl5dV2sDEH5WT8jycHBuLSKBZrkbfE4luhkUMDRnqf+CnLsSx4pRhYAEWYB7m9gB/Hp1QkPquRGZfQWWI0FMjSCe7oxFZeVJar8QQCozQ0IdHG4Ip9jvPUZScRK9rqfN0xV0/FZpR3c50YyM3xMHya+SAV/1Ttls/O+tSxmveQAMM5HaFJlJe7IugpM5OZXOD7zQQElzYIl+tCr81sNpJatW9kNMZAYCJef0ELZuZK/W3yiAr05bX91roGQw+H3zIc223Su4OJgt/D5QQ3LyQ7QS1BBtzAGm8fNyjOrDDBrrV6iheag13f1lKlr2UxUcRVV1+Hg==" . . . . . . . "Giorgio Castellan" . . . . "Kd Kw A nLw nLw B" . . "Estimation" . . "Mediterranean Sea" . "University of Hawai" . . . "reach the seabed" . . "satellite Kd" . . "physics" . . "attenuation coefficient KdPAR" . . "hydrography" . . "visible light" . . "seabed" . . "seabed in the Mediterranean Sea" . . "Mediterranean Sea" . . "m s" . . "estimation of light" . . "waters" . . "andthe Kd" . . "fluorescence" . . "relationships" . . "PAR" . . "sensors" . "C. Samples" . . . "andmodelled KdPAR" . . "species" . . "Satellite" . . "surface" . "Ed E" . . . "depth" . "RLCs" . . . "equivalent" . . "Estimation" . "estimate" . . "irradiance" . . "photons" . . "Morel" . . "algae" . . "nm" . . "Fm" . . "morel s Kd" . . "chemistry" . . "attenuation coefficient Kd" . . "seabed Estimation of PAR" . . "seabed Estimation" . "service-account-enrichment" . . . . "3397641"^^ . "https://api.rohub.org/api/ros/41a2f46e-9d0e-4bba-ac26-87c7a0ae3856/crate/download/" . . "2021-04-29 14:00:35.810000+00:00" . "2025-03-05 00:51:30.258243+00:00" . "2021-04-29 14:00:35.810000+00:00" . "Estimation of PAR light reaching the seabed in the Mediterranean Sea" . "application/ld+json" . . . . . "https://w3id.org/ro-id/41a2f46e-9d0e-4bba-ac26-87c7a0ae3856" . "Mesophotic Zone, Light at seabed, Mediterranean Sea" . . "Estimation of light at seabed" . . . . . . . "Giorgio Castellan. \"Estimation of light at seabed.\" ROHub. Apr 29 ,2021. https://w3id.org/ro-id/41a2f46e-9d0e-4bba-ac26-87c7a0ae3856." . "web services" . . . "software" . . . "components" . . . . . . "inputs" . . . . . "datasets" . . . . . . . "config" . . . "results" . . . "produced" . . . "nested" . . . "main" . . . "scripts" . . . . . "biblio" . . . . . . "workflows" . . . "setup" . . . . . "used" . . . . "439711"^^ . "https://api.rohub.org/api/resources/2274ebbc-d191-4931-b861-6e83165a2c32/download/" . . "2021-04-29 14:02:59.465000+00:00" . "2022-03-24 13:19:09.850550+00:00" . "application/pdf" . . "Runcieetal2008.pdf" . "2021-04-29 14:02:59.465000+00:00" . . . . . "1753877"^^ . "https://api.rohub.org/api/resources/990815c4-3542-4b48-8290-056c055633fd/download/" . . "2021-04-29 14:03:11.390000+00:00" . "2022-03-24 13:19:10.921810+00:00" . "application/pdf" . . "Salquinetal2013.pdf" . "2021-04-29 14:03:11.390000+00:00" . . . . . "771593"^^ . "https://api.rohub.org/api/resources/c5b90b04-7070-4215-b64c-4febbccc5d7f/download/" . . "2021-04-29 14:05:46.800000+00:00" . "2022-03-24 13:19:14.443309+00:00" . "image/tiff" . . "Bathymetry" . "2021-04-29 14:05:46.800000+00:00" . . . . "1574331"^^ . "https://api.rohub.org/api/resources/cf7e33ee-3826-4cfc-a798-eddc323eb72e/download/" . . "2021-04-29 14:04:28.758000+00:00" . "2022-03-24 13:19:15.456932+00:00" . "image/tiff" . . "Mean_kd490_2002-2018" . "2021-04-29 14:04:28.758000+00:00" . . . . "1574325"^^ . "https://api.rohub.org/api/resources/f0e4289d-f889-49a3-8c5b-fa79794d845c/download/" . . "2021-04-29 14:04:10.572000+00:00" . "2022-03-24 13:19:16.464477+00:00" . "image/tiff" . . "Mean_surfacePAR_2002-2018" . "2021-04-29 14:04:10.572000+00:00" . . . . . . "service-account-generation-service" . . . "2026-05-19T13:47:30.903+02:00"^^ . . . . . "Estimation of light at seabed" . "RSA" . "MIIBIjANBgkqhkiG9w0BAQEFAAOCAQ8AMIIBCgKCAQEAxszSDYX5tuCSkP7UiCtftYPFNQVTjgNu0I5fwdML2DLRDlp0xzmsQXRk8oHuvwGvG1aMjj6cpUqO+0rz2Sg/wvHOgUpkRH8VJXvmlkhafMLCMtUtk5JIx7e+fkzCby+fnmD7kMkGLrT+OaExWwEDmNlCAt0TPKcHSdwsjso2isXjtAsGevyCMke8ufnFYpjs746JES1eNzVnHnn2Kp/lqcm60GM+J8dLgRZp7fX0anW098xhKym6+xXFzqeju0vYRIHBPerv+r7skWxwk+a7Sd8msqVeYEv6NTqnyWvyWb6Yh8cvj04N6qm/T6C5FUPLQhzSaQgMVMU6yLqjPuu9DwIDAQAB" . "FP26WfUB8kvf3U+xPFGhvVUG+xAmD/agugr815AFAcO8hxDbMN+M2SwkPBZaTRH3U20RS4+6Lf1usAFBBYhwnNb9xagmt6ZtzxSc4etEuaoABjigdpfWNEpV3NH0HStG6NZUGvILycY0ThxuG0cSHKAkP5tEDjut4unK2lCy4Fw38imjMVPzyx+QKqs9EgHIziF/E2Cd/EIuH0NrODUYywjg6nmtjSSANvpK3/jGjBCm5/i3CxEp0Dj9hggFJUFeWl7stltBr2yzsJYpj2dSl7WEN9o8C8AwyX/oINaybLlKUPzX2ETxIHGCVDc+mhdj34Vkd7d8v+55BVWrkBcg3g==" . . . . . . . . "Earth system model" . . "resolution mesh" . . "Norwegian Earth system model" . . "generate a Variable Resolution Mesh" . . "tool" . . "container" . . "system model" . . "mechanics" . . "industry" . . "create container" . . "Resolution" . . "Mesh" . . "create container" . "Anne Fouilloux" . . . "service-account-enrichment" . . . . "632799"^^ . "https://api.rohub.org/api/ros/170460ba-d68c-4090-96de-6ed98f6b453a/crate/download/" . . "2021-04-29 13:53:58.420000+00:00" . "2025-03-05 02:46:54.890197+00:00" . "2021-04-29 13:53:58.420000+00:00" . "Dockerfile to create container for generating a new Variable Resolution Mesh for running the Norwegian Earth System Model (NorESM) or Community Earth System Model (CESM)" . "application/ld+json" . . . "https://w3id.org/ro-id/170460ba-d68c-4090-96de-6ed98f6b453a" . "climate" . "docker" . . "Tool to generate a Variable Resolution Mesh for CESM/NorESM" . . . . . . "Fouilloux, Anne. \"Tool to generate a Variable Resolution Mesh for CESM/NorESM.\" ROHub. Apr 29 ,2021. https://w3id.org/ro-id/170460ba-d68c-4090-96de-6ed98f6b453a." . . "633767"^^ . "https://api.rohub.org/api/resources/7c1a3ee3-ef9b-4b93-9596-91a35e16a51d/download/" . . "2021-04-29 14:03:16.917000+00:00" . "2022-03-24 13:19:35.494593+00:00" . "image/png" . . "Grid-Norway-example.png" . "2021-04-29 14:03:16.917000+00:00" . . . . . "https://github.com/NordicESMhub/docker-vrm-editor" . . "2021-04-29 13:53:58.420000+00:00" . "2022-03-24 13:19:34.143229+00:00" . . "https://github.com/NordicESMhub/docker-vrm-editor" . "2021-04-29 13:53:58.420000+00:00" . . . . . . . "service-account-generation-service" . . . "2026-05-19T13:47:30.596+02:00"^^ . . . . . "Tool to generate a Variable Resolution Mesh for CESM/NorESM" . "RSA" . "MIIBIjANBgkqhkiG9w0BAQEFAAOCAQ8AMIIBCgKCAQEAxszSDYX5tuCSkP7UiCtftYPFNQVTjgNu0I5fwdML2DLRDlp0xzmsQXRk8oHuvwGvG1aMjj6cpUqO+0rz2Sg/wvHOgUpkRH8VJXvmlkhafMLCMtUtk5JIx7e+fkzCby+fnmD7kMkGLrT+OaExWwEDmNlCAt0TPKcHSdwsjso2isXjtAsGevyCMke8ufnFYpjs746JES1eNzVnHnn2Kp/lqcm60GM+J8dLgRZp7fX0anW098xhKym6+xXFzqeju0vYRIHBPerv+r7skWxwk+a7Sd8msqVeYEv6NTqnyWvyWb6Yh8cvj04N6qm/T6C5FUPLQhzSaQgMVMU6yLqjPuu9DwIDAQAB" . "la8qOXvil3BdRdvGQ0sIF3AB7l45WFwNPEsKvMyde5OVnq/Fqn1W7N4vOTWUHKk7kXXb8gZgSjuaZXMcwL3KZw+ivb6Yh8YXIrPJulmDvlGOlBLE75FjyfQLXMPIoL9EC+U3cRPeZmynKec/TN2Z+47o1e7U/AgHccQ4KgwsMbCgbvBvS0/a1l+hKOz37BPtLxzqa0KkQDbOGounefpfO9VqEwObC0DoZb5xDC8yoSW/L25t5uY6BuWnP+XZQL5qzSMQq1gk7uugnYQ4qz8mLfr65B7MFIgucEpTysyuteos228ux0nsnmt+iWVbTWnFI6MMcH0nOGI3Ts7GVYgyVw==" . . . . . . . . "https://data.psychosensing.psnc.pl/popane/" . . "http://w3id.org/ro-id/rohub/model#change_specifications/fc6484e8-4439-4613-8d15-829595d4f06b/changes/0bc05a93-4468-4daa-b126-d9d0080793f5" . "http://w3id.org/ro-id/rohub/model#change_specifications/fc6484e8-4439-4613-8d15-829595d4f06b/changes/18262614-b883-4213-ba15-7efb9ef0c268" . "http://w3id.org/ro-id/rohub/model#change_specifications/fc6484e8-4439-4613-8d15-829595d4f06b/changes/1a2fb661-520b-4cb3-88fd-21449f291d62" . "http://w3id.org/ro-id/rohub/model#change_specifications/fc6484e8-4439-4613-8d15-829595d4f06b/changes/2434635a-b321-4515-814d-bfc164b0ddbf" . "http://w3id.org/ro-id/rohub/model#change_specifications/fc6484e8-4439-4613-8d15-829595d4f06b/changes/280836c2-08a2-48f4-ba92-611944e81438" . "http://w3id.org/ro-id/rohub/model#change_specifications/fc6484e8-4439-4613-8d15-829595d4f06b/changes/2a6098e7-4eb7-4324-93da-87c4ae8e7767" . "http://w3id.org/ro-id/rohub/model#change_specifications/fc6484e8-4439-4613-8d15-829595d4f06b/changes/42c378aa-a0c1-40a6-beaf-30bd0fbadf94" . "http://w3id.org/ro-id/rohub/model#change_specifications/fc6484e8-4439-4613-8d15-829595d4f06b/changes/48aff3bb-58db-418c-933b-2283ee3ed3b7" . "http://w3id.org/ro-id/rohub/model#change_specifications/fc6484e8-4439-4613-8d15-829595d4f06b/changes/60cfb7d8-f6d8-4496-9713-0aeaab27d33f" . "http://w3id.org/ro-id/rohub/model#change_specifications/fc6484e8-4439-4613-8d15-829595d4f06b/changes/6dea5925-4ec2-433c-bf39-a086fddbb38f" . "http://w3id.org/ro-id/rohub/model#change_specifications/fc6484e8-4439-4613-8d15-829595d4f06b/changes/715482ca-cb0e-4537-8e21-d56efbe424a5" . "http://w3id.org/ro-id/rohub/model#change_specifications/fc6484e8-4439-4613-8d15-829595d4f06b/changes/73b18050-743d-4399-bc6b-bfb83170977b" . "http://w3id.org/ro-id/rohub/model#change_specifications/fc6484e8-4439-4613-8d15-829595d4f06b/changes/7a5b2560-300b-428b-9a2f-cd0754cf7ef7" . "http://w3id.org/ro-id/rohub/model#change_specifications/fc6484e8-4439-4613-8d15-829595d4f06b/changes/8f3686b9-49d1-452d-94a5-34f710fa8c45" . "http://w3id.org/ro-id/rohub/model#change_specifications/fc6484e8-4439-4613-8d15-829595d4f06b/changes/a5c2968d-aade-40a5-87f8-56e44a9c31c0" . "http://w3id.org/ro-id/rohub/model#change_specifications/fc6484e8-4439-4613-8d15-829595d4f06b/changes/af95cdce-53c4-4bdb-a151-fabd92f7c1a5" . "http://w3id.org/ro-id/rohub/model#change_specifications/fc6484e8-4439-4613-8d15-829595d4f06b/changes/c3857ff4-354e-4743-9b34-00b730e90865" . "http://w3id.org/ro-id/rohub/model#change_specifications/fc6484e8-4439-4613-8d15-829595d4f06b/changes/c74c0578-27ae-4eff-a2c8-06d2f18c29ff" . "http://w3id.org/ro-id/rohub/model#change_specifications/fc6484e8-4439-4613-8d15-829595d4f06b/changes/dad2afa4-d488-45c6-80ae-f7151b8f5cda" . "http://w3id.org/ro-id/rohub/model#change_specifications/fc6484e8-4439-4613-8d15-829595d4f06b/changes/dcfc465c-fe1b-4813-aaac-7cbee2ed6b76" . "http://w3id.org/ro-id/rohub/model#change_specifications/fc6484e8-4439-4613-8d15-829595d4f06b/changes/f0dfed13-1bb6-45cf-8c26-5cffebe1a92b" . . "http://sandbox.rohub.org/rodl/ROs/POPANE-snapshot/.ro/annotations/4fc6bb24-30b8-4f75-bb20-bf918c2a68bd" . . . "http://sandbox.rohub.org/rodl/ROs/POPANE-snapshot/b001884b-488c-4eac-9dea-f8d72835ae5b.rdf" . . . "http://sandbox.rohub.org/rodl/ROs/POPANE-snapshot/Biblio/Used/" . . . "http://sandbox.rohub.org/rodl/ROs/POPANE-snapshot/.ro/annotations/0aa381b4-a3d1-4d8d-9e7f-6a467316a88c" . . . "http://sandbox.rohub.org/rodl/ROs/POPANE-snapshot/.ro/annotations/78b435fd-a279-4eb0-9efc-28b30b4449c6" . . . "https://data.psychosensing.psnc.pl/popane/" . . . "http://sandbox.rohub.org/rodl/ROs/POPANE-snapshot/b1341f84-3ebd-4b97-9aba-cc0d0333a33c.rdf" . . . "http://sandbox.rohub.org/rodl/ROs/POPANE-snapshot/Dataset/" . . . "http://sandbox.rohub.org/rodl/ROs/POPANE-snapshot/9e5265b5-801d-4946-a8f7-671d2981d6c3.rdf" . . . "http://sandbox.rohub.org/rodl/ROs/POPANE-snapshot/4ddadbf1-01d7-492b-baab-1332e08aa649.rdf" . . . "http://sandbox.rohub.org/rodl/ROs/POPANE-snapshot/eb9c26a6-5b57-4228-a542-8699c56d4e07.rdf" . . . "http://sandbox.rohub.org/rodl/ROs/POPANE-snapshot/831adf3a-50aa-485a-8706-c2e79a87fa2a.rdf" . . . "http://sandbox.rohub.org/rodl/ROs/POPANE-snapshot/Dataset/Metadata/" . . . "http://sandbox.rohub.org/rodl/ROs/POPANE-snapshot/Raw Data/" . . . "http://sandbox.rohub.org/rodl/ROs/POPANE-snapshot/Dataset/Data/" . . . "http://sandbox.rohub.org/rodl/ROs/POPANE-snapshot/Biblio/Produced/" . . . "http://sandbox.rohub.org/rodl/ROs/POPANE-snapshot/Documentation/" . . . "http://sandbox.rohub.org/rodl/ROs/POPANE-snapshot/.ro/annotations/090f613e-addb-42b6-aeff-98f6caa181ec" . . . "http://sandbox.rohub.org/rodl/ROs/POPANE-snapshot/.ro/annotations/24927f4c-e014-42aa-bb57-c5136fc4f860" . . . "http://sandbox.rohub.org/rodl/ROs/POPANE-snapshot/Biblio/" . . . "http://sandbox.rohub.org/rodl/ROs/POPANE-snapshot/.ro/annotations/00494a03-ca6b-4bba-899a-ca29166fc856" . . . . "physiology" . . "recorded affect" . . "dataset" . . "impedance cardiography" . . "activity" . "International Crisis Group" . . . "electrocardiography" . . "emotions" . "Szymon KupiÅ?ski" . . "service-account-enrichment" . . . "false" . "http://sandbox.rohub.org/rodl/ROs/POPANE/" . "2021-03-11T15:18:55.068+01:00" . "https://orcid.org/0000-0002-4704-6802" . "http://w3id.org/ro-id/rohub/model#change_specifications/fc6484e8-4439-4613-8d15-829595d4f06b" . . "9986"^^ . "https://api.rohub.org/api/ros/6a6127bb-03b0-4d0c-a5a9-52cfd0913fd4/crate/download/" . . "2021-03-11 14:18:55.068000+00:00" . "2025-03-05 01:17:00.319175+00:00" . "2021-03-11 14:18:55.068000+00:00" . "Subjective experience along with physiological activity are fundamental components of emotional responding. We present a publicly available dataset of psychophysiological responses to positive and negative emotions of 1157 healthy participants, collected across seven studies. In our studies were continuously recorded affect and physiological activity during resting baseline and emotional responding. We recorded physiological responses using electrocardiography (EKG), impedance cardiography (ICG), electrodermal activity (EDA), photoplethysmography (PPG, the blood pressure measures), respiratory, and temperature sensors. In our studies, we elicited emotions with films, pictures, speech preparation, and expressive writing. We studied a wide range of positive and negative emotions, including: amusement, anger, disgust, excitement, fear, gratitude, sadness, tenderness, and threat. To the best of our knowledge, Psychophysiology of Positive and Negative Emotions (POPANE) database is the largest, consistent psychophysiological dataset on emotions ever collected and publicly shared. We hope that POPANE will provide individuals, companies, and laboratories with the data they need to perform their own analyses, corroborate their results, and create robust psychophysiological models of emotions." . "application/ld+json" . . . . . . "https://w3id.org/ro-id/6a6127bb-03b0-4d0c-a5a9-52cfd0913fd4" . . "Psychophysiology of Positive and Negative Emotions (POPANE) – a dataset of over 1000 participants" . "database" . "dataset" . "electrocardiography" . "emotion" . "experience" . "individual" . "information" . "laboratory" . "participant" . "plethysmography" . "response" . "testing" . "environmental sciences" . "Biology" . "Medical procedure-test" . "Psychology" . "Science and technology" . "Psychophysiology of Positive and Negative Emotions" . "data" . "database" . "dataset" . "emotion" . "individual" . "participant" . "life sciences" . "available dataset" . "dataset of psychophysiological response" . "electrodermal activity" . "models of emotion" . "subjective experience" . "To the best of our knowledge, Psychophysiology of Positive and Negative Emotions (POPANE) database is the largest, consistent psychophysiological dataset on emotions ever collected and publicly shared." . "We hope that POPANE will provide individuals, companies, and laboratories with the data they need to perform their own analyses, corroborate their results, and create robust psychophysiological models of emotions." . "We present a publicly available dataset of psychophysiological responses to positive and negative emotions of 1157 healthy participants, collected across seven studies." . . . . . . "http://sandbox.rohub.org/rodl/ROs/POPANE-snapshot/" . "medicine" . "psychology" . "Szymon KupiÅ?ski. \"Psychophysiology of Positive and Negative Emotions (POPANE) – a dataset of over 1000 participants.\" ROHub. Mar 11 ,2021. https://w3id.org/ro-id/6a6127bb-03b0-4d0c-a5a9-52cfd0913fd4." . "Metadata" . . . . . "Biblio" . . . "Raw Data" . . . . . "Dataset" . . . "Data" . . . "Used" . . . "Produced" . . . "Documentation" . . . . "https://data.psychosensing.psnc.pl/popane/" . . "2022-03-24 13:24:28.053728+00:00" . "2022-03-24 13:24:29.534204+00:00" . . "https://data.psychosensing.psnc.pl/popane/" . "2022-03-24 13:24:28.053728+00:00" . . . . . . . "service-account-generation-service" . . . "2026-05-19T13:47:30.285+02:00"^^ . . . . . "Psychophysiology of Positive and Negative Emotions (POPANE) – a dataset of over 1000 participants" . "RSA" . "MIIBIjANBgkqhkiG9w0BAQEFAAOCAQ8AMIIBCgKCAQEAxszSDYX5tuCSkP7UiCtftYPFNQVTjgNu0I5fwdML2DLRDlp0xzmsQXRk8oHuvwGvG1aMjj6cpUqO+0rz2Sg/wvHOgUpkRH8VJXvmlkhafMLCMtUtk5JIx7e+fkzCby+fnmD7kMkGLrT+OaExWwEDmNlCAt0TPKcHSdwsjso2isXjtAsGevyCMke8ufnFYpjs746JES1eNzVnHnn2Kp/lqcm60GM+J8dLgRZp7fX0anW098xhKym6+xXFzqeju0vYRIHBPerv+r7skWxwk+a7Sd8msqVeYEv6NTqnyWvyWb6Yh8cvj04N6qm/T6C5FUPLQhzSaQgMVMU6yLqjPuu9DwIDAQAB" . "MZlNenDTFlj74wxA9yToiexLf1P4foVjUsXpnSRfKyITyOuh2AWGoVlzMcaboVflP0TiVEhUZp3AcayJDy7ihL8mygWuRmhFbnKfYu5Z1mMp/iKaEYx2wEoar+EMadglPyp6HviVpsOEwcLSsx8q9Ju0B1/HNLcwO6lOV+/gkGsvfMQufgi5ub+l5TKmSfseRae9T/mcutcdpdRf2BK3peAAwRttZlhSNl2kXTgYWkH+iYIhKqx5/sIJOv9ICAHSOoKXT0BG9WcMpjKB4BDjQmFlK0gtFm1cDtQ0OsZ1PNyfomXwbYmXTxSnDveucSwd3pJomAK1cCJ7XhacOxGf6Q==" . . . . . . . . "https://data.psychosensing.psnc.pl/popane/" . . . "physiology" . . "recorded affect" . . "dataset" . . "impedance cardiography" . . "activity" . "International Crisis Group" . . . "electrocardiography" . . "emotions" . . "Szymon KupiÅ?ski" . . "service-account-enrichment" . . . "false" . "http://sandbox.rohub.org/rodl/ROs/POPANE/" . "2021-03-11T14:49:03.095+01:00" . "https://orcid.org/0000-0002-2455-4556" . . "8794"^^ . "https://api.rohub.org/api/ros/fb39cfdd-d93a-4f89-af5f-2c944b85c05d/crate/download/" . . "2021-03-11 13:49:03.095000+00:00" . "2025-03-05 01:17:00.039657+00:00" . "2021-03-11 13:49:03.095000+00:00" . "Subjective experience along with physiological activity are fundamental components of emotional responding. We present a publicly available dataset of psychophysiological responses to positive and negative emotions of 1157 healthy participants, collected across seven studies. In our studies were continuously recorded affect and physiological activity during resting baseline and emotional responding. We recorded physiological responses using electrocardiography (EKG), impedance cardiography (ICG), electrodermal activity (EDA), photoplethysmography (PPG, the blood pressure measures), respiratory, and temperature sensors. In our studies, we elicited emotions with films, pictures, speech preparation, and expressive writing. We studied a wide range of positive and negative emotions, including: amusement, anger, disgust, excitement, fear, gratitude, sadness, tenderness, and threat. To the best of our knowledge, Psychophysiology of Positive and Negative Emotions (POPANE) database is the largest, consistent psychophysiological dataset on emotions ever collected and publicly shared. We hope that POPANE will provide individuals, companies, and laboratories with the data they need to perform their own analyses, corroborate their results, and create robust psychophysiological models of emotions." . "application/ld+json" . . . . . . "https://w3id.org/ro-id/fb39cfdd-d93a-4f89-af5f-2c944b85c05d" . . "Psychophysiology of Positive and Negative Emotions (POPANE) – a dataset of over 1000 participants" . "database" . "dataset" . "electrocardiography" . "emotion" . "experience" . "individual" . "information" . "laboratory" . "participant" . "plethysmography" . "response" . "testing" . "environmental sciences" . "Biology" . "Medical procedure-test" . "Psychology" . "Science and technology" . "Psychophysiology of Positive and Negative Emotions" . "data" . "database" . "dataset" . "emotion" . "individual" . "participant" . "life sciences" . "available dataset" . "dataset of psychophysiological response" . "electrodermal activity" . "models of emotion" . "subjective experience" . "To the best of our knowledge, Psychophysiology of Positive and Negative Emotions (POPANE) database is the largest, consistent psychophysiological dataset on emotions ever collected and publicly shared." . "We hope that POPANE will provide individuals, companies, and laboratories with the data they need to perform their own analyses, corroborate their results, and create robust psychophysiological models of emotions." . "We present a publicly available dataset of psychophysiological responses to positive and negative emotions of 1157 healthy participants, collected across seven studies." . . . . . . "medicine" . "psychology" . "Szymon KupiÅ?ski. \"Psychophysiology of Positive and Negative Emotions (POPANE) – a dataset of over 1000 participants.\" ROHub. Mar 11 ,2021. https://w3id.org/ro-id/fb39cfdd-d93a-4f89-af5f-2c944b85c05d." . . . "Biblio" . . . "Produced" . . . "Data" . . . "Metadata" . . . "Used" . . . "Raw Data" . . . . . "Dataset" . . . "Documentation" . . . . "https://data.psychosensing.psnc.pl/popane/" . . "2022-03-24 13:24:35.249281+00:00" . "2022-03-24 13:24:36.181299+00:00" . . "https://data.psychosensing.psnc.pl/popane/" . "2022-03-24 13:24:35.249281+00:00" . . . . . . . "service-account-generation-service" . . . "2026-05-19T13:47:29.973+02:00"^^ . . . . . "Psychophysiology of Positive and Negative Emotions (POPANE) – a dataset of over 1000 participants" . "RSA" . "MIIBIjANBgkqhkiG9w0BAQEFAAOCAQ8AMIIBCgKCAQEAxszSDYX5tuCSkP7UiCtftYPFNQVTjgNu0I5fwdML2DLRDlp0xzmsQXRk8oHuvwGvG1aMjj6cpUqO+0rz2Sg/wvHOgUpkRH8VJXvmlkhafMLCMtUtk5JIx7e+fkzCby+fnmD7kMkGLrT+OaExWwEDmNlCAt0TPKcHSdwsjso2isXjtAsGevyCMke8ufnFYpjs746JES1eNzVnHnn2Kp/lqcm60GM+J8dLgRZp7fX0anW098xhKym6+xXFzqeju0vYRIHBPerv+r7skWxwk+a7Sd8msqVeYEv6NTqnyWvyWb6Yh8cvj04N6qm/T6C5FUPLQhzSaQgMVMU6yLqjPuu9DwIDAQAB" . "Ru7AGvPId3Aqpk+GZQWKnGTF6V50/QR2jIJ/LZmTH5ltXpCdzbH9uEEeAngv0DzXGAMadpDC8PC1KZaQK4cDls+oC8rHjHcbfOYTFCko+ajrMQf5eoIXJpsZZ3X4MIyj5dFIUDAxcL9vLv4NTGYD0eD/cR6GP7ETaheTcpC9fWS9iXluxs+v6AB4JVR8FRghF7mPuPl60VBZt6Lnk1C2RbPgK54GdDS4OipGHXctjZGoQh4BjfelWEd1qKlI8Jxk7VYf38+tj0zrhx7C81MJF8y18WcWMa3OHYNP428mYG7ZRbbM6yNCtgJlj0odRumn+FN90FKGqCNUYai3tTXS6w==" . . . . . . . "" . "Neurobiology" . . "http://sandbox.rohub.org/rodl/ROs/POPANE-1-fork/" . . . "http://w3id.org/ro-id/rohub/model#change_specifications/2b6b4a8f-9933-497e-bf11-4137ffdaf516/changes/0c67378d-9501-4a8c-8477-33570a984349" . "http://w3id.org/ro-id/rohub/model#change_specifications/2b6b4a8f-9933-497e-bf11-4137ffdaf516/changes/2540f165-0e17-4152-944a-67c59a311d5e" . . "https://data.psychosensing.psnc.pl/popane/index.html" . . . "https://data.psychosensing.psnc.pl/popane/index.html" . . . . "psychology" . . "physiology" . . "popane dataset" . . "psychophysiology Of Positive" . . "medicine" . . "database" . . "data" . . "electrocardiography" . . "dataset" . . "neuropsychology" . . "DATASET" . . "impedance cardiography" . "Of Positive" . . . "emotion" . . "POPANE dataset" . . "studies" . . "psychophysiology of positive" . . "activity" . . "plethysmography" . "International Crisis Group" . . . "experience" . . "individual" . . "impedance cardiography" . . "emotions" . . "information" . . "response" . . "individuals data" . "Maciej Behnke" . . "service-account-enrichment" . . . "http://sandbox.rohub.org/rodl/ROs/POPANE-1/" . "2021-03-11T14:07:59.683+01:00" . "https://orcid.org/0000-0002-2455-4556" . "http://w3id.org/ro-id/rohub/model#change_specifications/2b6b4a8f-9933-497e-bf11-4137ffdaf516" . . . "9094"^^ . "https://api.rohub.org/api/ros/a3a81739-a5b7-4897-b732-7aba23d6fa5a/crate/download/" . . "2021-03-11 13:07:59.683000+00:00" . "2025-03-05 01:14:11.927117+00:00" . "2021-03-11 13:07:59.683000+00:00" . "Subjective experience along with physiological activity are fundamental components of emotional responding. We present a publicly available dataset of psychophysiological responses to positive and negative emotions of 1157 healthy participants, collected across seven studies. In our studies were continuously recorded affect and physiological activity during resting baseline and emotional responding. We recorded physiological responses using electrocardiography (ECG), impedance cardiography (ICG), electrodermal activity (EDA), photoplethysmography (PPG, the blood pressure measures), respiratory, and temperature sensors. In our studies, we elicited emotions with films, pictures, speech preparation, and expressive writing. We studied a wide range of positive and negative emotions, including amusement, anger, disgust, excitement, fear, gratitude, sadness, tenderness, and threat. To the best of our knowledge, psychophysiology of positive and negative emotions (POPANE) database is the largest, consistent psychophysiological dataset on emotions ever collected and publicly shared. We hope that POPANE will provide individuals, companies, and laboratories with the data they need to perform their analyses, corroborate their results, and create robust psychophysiological models of emotions. The individuals data are openly available in POPANE dataset at https://data.psychosensing.psnc.pl/popane/index.html. " . "Subjective experience along with physiological activity are fundamental components of emotional responding. We present a publicly available dataset of psychophysiological responses to positive and negative emotions of 1157 healthy participants, collected across seven studies. In our studies were continuously recorded affect and physiological activity during resting baseline and emotional responding. We recorded physiological responses using electrocardiography (ECG), impedance cardiography (ICG), electrodermal activity (EDA), photoplethysmography (PPG, the blood pressure measures), respiratory, and temperature sensors. In our studies, we elicited emotions with films, pictures, speech preparation, and expressive writing. We studied a wide range of positive and negative emotions, including amusement, anger, disgust, excitement, fear, gratitude, sadness, tenderness, and threat. To the best of our knowledge, psychophysiology of positive and negative emotions (POPANE) database is the largest, consistent psychophysiological dataset on emotions ever collected and publicly shared. We hope that POPANE will provide individuals, companies, and laboratories with the data they need to perform their analyses, corroborate their results, and create robust psychophysiological models of emotions. The individuals data are openly available in POPANE dataset at https://data.psychosensing.psnc.pl/popane/index.html." . "application/ld+json" . . . . . . "https://w3id.org/ro-id/a3a81739-a5b7-4897-b732-7aba23d6fa5a" . . "POPANE DATASET - Psychophysiology Of Positive And Negative Emotions" . . . . . . "http://sandbox.rohub.org/rodl/ROs/POPANE-1-snapshot-1/" . "https://w3id.org/ro-id/a3a81739-a5b7-4897-b732-7aba23d6fa5a" . "Maciej Behnke. \"POPANE DATASET - Psychophysiology Of Positive And Negative Emotions.\" ROHub. Mar 11 ,2021. https://w3id.org/ro-id/a3a81739-a5b7-4897-b732-7aba23d6fa5a." . "Raw Data" . . . "Used" . . . "Data" . . . . . "Dataset" . . . "Metadata" . . . "Produced" . . . . . "Biblio" . . . "Documentation" . . . . "https://data.psychosensing.psnc.pl/popane/index.html" . . "2022-03-24 13:24:42.715170+00:00" . "2022-03-24 13:24:43.719920+00:00" . "text/html" . . "https://data.psychosensing.psnc.pl/popane/index.html" . "2022-03-24 13:24:42.715170+00:00" . . . . . . . "service-account-generation-service" . . . "2026-05-19T13:47:29.750+02:00"^^ . . . . . "POPANE DATASET - Psychophysiology Of Positive And Negative Emotions" . "RSA" . "MIIBIjANBgkqhkiG9w0BAQEFAAOCAQ8AMIIBCgKCAQEAxszSDYX5tuCSkP7UiCtftYPFNQVTjgNu0I5fwdML2DLRDlp0xzmsQXRk8oHuvwGvG1aMjj6cpUqO+0rz2Sg/wvHOgUpkRH8VJXvmlkhafMLCMtUtk5JIx7e+fkzCby+fnmD7kMkGLrT+OaExWwEDmNlCAt0TPKcHSdwsjso2isXjtAsGevyCMke8ufnFYpjs746JES1eNzVnHnn2Kp/lqcm60GM+J8dLgRZp7fX0anW098xhKym6+xXFzqeju0vYRIHBPerv+r7skWxwk+a7Sd8msqVeYEv6NTqnyWvyWb6Yh8cvj04N6qm/T6C5FUPLQhzSaQgMVMU6yLqjPuu9DwIDAQAB" . "GBKv4qrIPm/dfS7rOAce30FR27w7Z6Jaae9OK6xxj2cJHu2wbpz3jhX/HZkaNFmyUbxdmCwPf+T0IWzNGBXDFGgtaqj6zkoUU/UBTDuURwWAvuOMNrxJ+fuTzkb5jwcGSYYQFYtWO3Ev6mukFWYm4t/6Kfn4hCz3bvkoobXOq7K1UC0MjYcWV55mSXBoTjOgGg1zWfve9aGxNjALGBjmV/zIm2HQwey29SSlD4psJjKwq9Ics/2i3N+PYM2ycSDZj95XYm4ah29v6Jolhm3N/lCTw995Eq8GYv/lfHMqIale4roBV4Z7HbH7voTUbbempL/T9xk1SExHPuXufPpRDw==" . . . . . . . "" . "Neurobiology" . . . "http://w3id.org/ro-id/rohub/model#change_specifications/39096823-9a1d-424b-8c9d-f251f9141b1e/changes/13a330d3-7227-4390-975b-bac1e8ca09a6" . "http://w3id.org/ro-id/rohub/model#change_specifications/39096823-9a1d-424b-8c9d-f251f9141b1e/changes/1537ef8d-acb1-4151-bcac-366d4ad7f8cc" . "http://w3id.org/ro-id/rohub/model#change_specifications/39096823-9a1d-424b-8c9d-f251f9141b1e/changes/1e8ad0f0-efd4-462e-8308-da0cdf2a6635" . "http://w3id.org/ro-id/rohub/model#change_specifications/39096823-9a1d-424b-8c9d-f251f9141b1e/changes/3b5431f1-16e3-40e9-81ec-75b7409ce166" . "http://w3id.org/ro-id/rohub/model#change_specifications/39096823-9a1d-424b-8c9d-f251f9141b1e/changes/4b5f4313-5319-4e55-b903-60eb4f494a87" . "http://w3id.org/ro-id/rohub/model#change_specifications/39096823-9a1d-424b-8c9d-f251f9141b1e/changes/4d0bdd18-de81-42ca-9958-cd40e3764e03" . "http://w3id.org/ro-id/rohub/model#change_specifications/39096823-9a1d-424b-8c9d-f251f9141b1e/changes/5dac0afa-400a-439f-82ef-4a217d92cc0c" . "http://w3id.org/ro-id/rohub/model#change_specifications/39096823-9a1d-424b-8c9d-f251f9141b1e/changes/6aa6ff5d-03ce-4f67-8906-4d3e824a0ea7" . "http://w3id.org/ro-id/rohub/model#change_specifications/39096823-9a1d-424b-8c9d-f251f9141b1e/changes/6cf270fa-cbf5-46bc-9c53-22495fabcbff" . "http://w3id.org/ro-id/rohub/model#change_specifications/39096823-9a1d-424b-8c9d-f251f9141b1e/changes/9170008c-9dbf-4960-860b-2c5e60f129e7" . "http://w3id.org/ro-id/rohub/model#change_specifications/39096823-9a1d-424b-8c9d-f251f9141b1e/changes/9d114497-1d87-423a-ac3c-88611d4545de" . "http://w3id.org/ro-id/rohub/model#change_specifications/39096823-9a1d-424b-8c9d-f251f9141b1e/changes/a085d8ff-2789-40d2-b02e-25adad26756e" . "http://w3id.org/ro-id/rohub/model#change_specifications/39096823-9a1d-424b-8c9d-f251f9141b1e/changes/b487e6fa-059d-4179-8933-8986f68a9aef" . "http://w3id.org/ro-id/rohub/model#change_specifications/39096823-9a1d-424b-8c9d-f251f9141b1e/changes/bd391d18-3a4c-4e13-9bf8-158df83dd67e" . "http://w3id.org/ro-id/rohub/model#change_specifications/39096823-9a1d-424b-8c9d-f251f9141b1e/changes/ce4bfe3e-e86e-4dc6-80c7-5da93e9b3efc" . "http://w3id.org/ro-id/rohub/model#change_specifications/39096823-9a1d-424b-8c9d-f251f9141b1e/changes/d6539b35-237a-4635-be8d-918b07a71273" . "http://w3id.org/ro-id/rohub/model#change_specifications/39096823-9a1d-424b-8c9d-f251f9141b1e/changes/ddbad6aa-1e65-47b1-af8b-c85e7df4d2ab" . "http://w3id.org/ro-id/rohub/model#change_specifications/39096823-9a1d-424b-8c9d-f251f9141b1e/changes/df5cada1-f27d-478c-af7c-d09dda889a7c" . "http://w3id.org/ro-id/rohub/model#change_specifications/39096823-9a1d-424b-8c9d-f251f9141b1e/changes/e8578a14-34ee-42c9-946c-1b526624dd3d" . "http://w3id.org/ro-id/rohub/model#change_specifications/39096823-9a1d-424b-8c9d-f251f9141b1e/changes/f0d8f936-3421-4f9c-8eb8-506a58cb8308" . "http://w3id.org/ro-id/rohub/model#change_specifications/39096823-9a1d-424b-8c9d-f251f9141b1e/changes/fddd1cb5-0881-4100-80d1-01ffd02eb172" . . "http://sandbox.rohub.org/rodl/ROs/POPANE-1-snapshot/.ro/annotations/3873b1fe-d809-415a-8d11-e90ebf558af2" . . . "http://sandbox.rohub.org/rodl/ROs/POPANE-1-snapshot/43deb517-0e69-44af-ad41-aad4905db16b.rdf" . . . "http://sandbox.rohub.org/rodl/ROs/POPANE-1-snapshot/94afb3a9-fd53-4a8a-8a55-977c39177e99.rdf" . . . "http://sandbox.rohub.org/rodl/ROs/POPANE-1-snapshot/19cf2f0e-4d72-4bc6-a60d-9817fb8d1f6c.rdf" . . . "http://sandbox.rohub.org/rodl/ROs/POPANE-1-snapshot/Raw Data/" . . . "https://data.psychosensing.psnc.pl/popane/index.html" . . . "http://sandbox.rohub.org/rodl/ROs/POPANE-1-snapshot/Documentation/" . . . "http://sandbox.rohub.org/rodl/ROs/POPANE-1-snapshot/Biblio/" . . . "http://sandbox.rohub.org/rodl/ROs/POPANE-1-snapshot/5b983955-1840-4e86-9178-cc0454844dbf.rdf" . . . "http://sandbox.rohub.org/rodl/ROs/POPANE-1-snapshot/Biblio/Used/" . . . "http://sandbox.rohub.org/rodl/ROs/POPANE-1-snapshot/Dataset/Metadata/" . . . "http://sandbox.rohub.org/rodl/ROs/POPANE-1-snapshot/.ro/annotations/355937d7-ef29-41ff-8e7d-15836a3d9f03" . . . "http://sandbox.rohub.org/rodl/ROs/POPANE-1-snapshot/Dataset/Data/" . . . "http://sandbox.rohub.org/rodl/ROs/POPANE-1-snapshot/Biblio/Produced/" . . . "http://sandbox.rohub.org/rodl/ROs/POPANE-1-snapshot/Dataset/" . . . "http://sandbox.rohub.org/rodl/ROs/POPANE-1-snapshot/c7048c73-1afe-45a7-9533-f713b979a6a6.rdf" . . . "http://sandbox.rohub.org/rodl/ROs/POPANE-1-snapshot/.ro/annotations/a8ae63af-ecc4-4932-9b3c-f8cb45bfb457" . . . "http://sandbox.rohub.org/rodl/ROs/POPANE-1-snapshot/.ro/annotations/4d09cc61-57e4-410f-91bc-27d8a36d01af" . . . "http://sandbox.rohub.org/rodl/ROs/POPANE-1-snapshot/27d1a872-fc2c-4ba9-96fe-ebf81759727c.rdf" . . . "http://sandbox.rohub.org/rodl/ROs/POPANE-1-snapshot/.ro/annotations/ea4c6885-0798-40bf-81e8-b9a3812205b0" . . . "http://sandbox.rohub.org/rodl/ROs/POPANE-1-snapshot/.ro/annotations/5c63a723-a83c-401a-bcea-04d44ac1f74c" . . . . "psychology" . . "physiology" . . "popane dataset" . . "psychophysiology Of Positive" . . "medicine" . . "database" . . "data" . . "electrocardiography" . . "dataset" . . "neuropsychology" . . "DATASET" . . "impedance cardiography" . "Of Positive" . . . "emotion" . . "POPANE dataset" . . "studies" . . "psychophysiology of positive" . . "activity" . . "plethysmography" . "International Crisis Group" . . . "experience" . . "individual" . . "impedance cardiography" . . "emotions" . . "information" . . "response" . . "individuals data" . "Maciej Behnke" . . "service-account-enrichment" . . . "false" . "http://sandbox.rohub.org/rodl/ROs/POPANE-1/" . "2021-03-11T14:05:41.562+01:00" . "https://orcid.org/0000-0002-2455-4556" . "http://w3id.org/ro-id/rohub/model#change_specifications/39096823-9a1d-424b-8c9d-f251f9141b1e" . . . "9801"^^ . "https://api.rohub.org/api/ros/78c3584e-592e-4af6-bf23-605e8a1b84c0/crate/download/" . . "2021-03-11 13:05:41.562000+00:00" . "2025-03-05 01:14:12.643536+00:00" . "2021-03-11 13:05:41.562000+00:00" . "Subjective experience along with physiological activity are fundamental components of emotional responding. We present a publicly available dataset of psychophysiological responses to positive and negative emotions of 1157 healthy participants, collected across seven studies. In our studies were continuously recorded affect and physiological activity during resting baseline and emotional responding. We recorded physiological responses using electrocardiography (ECG), impedance cardiography (ICG), electrodermal activity (EDA), photoplethysmography (PPG, the blood pressure measures), respiratory, and temperature sensors. In our studies, we elicited emotions with films, pictures, speech preparation, and expressive writing. We studied a wide range of positive and negative emotions, including amusement, anger, disgust, excitement, fear, gratitude, sadness, tenderness, and threat. To the best of our knowledge, psychophysiology of positive and negative emotions (POPANE) database is the largest, consistent psychophysiological dataset on emotions ever collected and publicly shared. We hope that POPANE will provide individuals, companies, and laboratories with the data they need to perform their analyses, corroborate their results, and create robust psychophysiological models of emotions. The individuals data are openly available in POPANE dataset at https://data.psychosensing.psnc.pl/popane/index.html. " . "Subjective experience along with physiological activity are fundamental components of emotional responding. We present a publicly available dataset of psychophysiological responses to positive and negative emotions of 1157 healthy participants, collected across seven studies. In our studies were continuously recorded affect and physiological activity during resting baseline and emotional responding. We recorded physiological responses using electrocardiography (ECG), impedance cardiography (ICG), electrodermal activity (EDA), photoplethysmography (PPG, the blood pressure measures), respiratory, and temperature sensors. In our studies, we elicited emotions with films, pictures, speech preparation, and expressive writing. We studied a wide range of positive and negative emotions, including amusement, anger, disgust, excitement, fear, gratitude, sadness, tenderness, and threat. To the best of our knowledge, psychophysiology of positive and negative emotions (POPANE) database is the largest, consistent psychophysiological dataset on emotions ever collected and publicly shared. We hope that POPANE will provide individuals, companies, and laboratories with the data they need to perform their analyses, corroborate their results, and create robust psychophysiological models of emotions. The individuals data are openly available in POPANE dataset at https://data.psychosensing.psnc.pl/popane/index.html." . "application/ld+json" . . . . . . "https://w3id.org/ro-id/78c3584e-592e-4af6-bf23-605e8a1b84c0" . . "POPANE DATASET - Psychophysiology Of Positive And Negative Emotions" . . . . . . "http://sandbox.rohub.org/rodl/ROs/POPANE-1-snapshot/" . "Maciej Behnke. \"POPANE DATASET - Psychophysiology Of Positive And Negative Emotions.\" ROHub. Mar 11 ,2021. https://w3id.org/ro-id/78c3584e-592e-4af6-bf23-605e8a1b84c0." . "Metadata" . . . . . "Dataset" . . . "Produced" . . . "Used" . . . "Documentation" . . . . . "Biblio" . . . "Data" . . . "Raw Data" . . . . "https://data.psychosensing.psnc.pl/popane/index.html" . . "2022-03-24 13:24:58.732136+00:00" . "2022-03-24 13:25:00.483590+00:00" . "text/html" . . "https://data.psychosensing.psnc.pl/popane/index.html" . "2022-03-24 13:24:58.732136+00:00" . . . . . . . "service-account-generation-service" . . . "2026-05-19T13:47:29.471+02:00"^^ . . . . . "POPANE DATASET - Psychophysiology Of Positive And Negative Emotions" . "RSA" . "MIIBIjANBgkqhkiG9w0BAQEFAAOCAQ8AMIIBCgKCAQEAxszSDYX5tuCSkP7UiCtftYPFNQVTjgNu0I5fwdML2DLRDlp0xzmsQXRk8oHuvwGvG1aMjj6cpUqO+0rz2Sg/wvHOgUpkRH8VJXvmlkhafMLCMtUtk5JIx7e+fkzCby+fnmD7kMkGLrT+OaExWwEDmNlCAt0TPKcHSdwsjso2isXjtAsGevyCMke8ufnFYpjs746JES1eNzVnHnn2Kp/lqcm60GM+J8dLgRZp7fX0anW098xhKym6+xXFzqeju0vYRIHBPerv+r7skWxwk+a7Sd8msqVeYEv6NTqnyWvyWb6Yh8cvj04N6qm/T6C5FUPLQhzSaQgMVMU6yLqjPuu9DwIDAQAB" . "rgONQK5JYpM6OAQPMBYL264nNp51/Bxlb9F3114ZWsI5mH0tl44Z81/iRqta7G7qcjEzU7mAqUTci0enQTT/MxE05R4Xn6oTPCtYuAZ1yvOkjhOGsiHGEmPqYhkN0y7csg8xgCKc19qJ5Epjr++1Eft7AObp4cn231If1mA0aXC3XZLk7JaztYprceFtlsAOnXctNMtlLKK1cMVlHp/41XnowDSIrBjclfzDaQCHVX8t2rr2riC+zCPTZqqqG4nA10+Au2VZg5XR2S4PF7l1uwjw6N48Ju8ncBy40NnYsUMWM+JMJQN3e8D54QR/zG6ksYjvT+KZpWVu7wzg0EAKhg==" . . . . . . . "" . "Neurobiology" . . . . "psychology" . . "physiology" . . "popane dataset" . . "psychophysiology Of Positive" . . "medicine" . . "database" . . "data" . . "electrocardiography" . . "dataset" . . "neuropsychology" . . "DATASET" . . "impedance cardiography" . "Of Positive" . . . "emotion" . . "POPANE dataset" . . "studies" . . "psychophysiology of positive" . . "activity" . . "plethysmography" . "International Crisis Group" . . . "experience" . . "individual" . . "impedance cardiography" . . "emotions" . . "information" . . "response" . . "individuals data" . "Maciej Behnke" . . "service-account-enrichment" . . . "false" . "http://sandbox.rohub.org/rodl/ROs/POPANE-1/" . "2021-03-11T14:04:33.909+01:00" . "https://orcid.org/0000-0002-2455-4556" . . . "8553"^^ . "https://api.rohub.org/api/ros/a415c54e-7d07-43c8-bcbe-1f76220f473f/crate/download/" . . "2021-03-11 13:04:33.909000+00:00" . "2025-03-05 01:14:12.144536+00:00" . "2021-03-11 13:04:33.909000+00:00" . "Subjective experience along with physiological activity are fundamental components of emotional responding. We present a publicly available dataset of psychophysiological responses to positive and negative emotions of 1157 healthy participants, collected across seven studies. In our studies were continuously recorded affect and physiological activity during resting baseline and emotional responding. We recorded physiological responses using electrocardiography (ECG), impedance cardiography (ICG), electrodermal activity (EDA), photoplethysmography (PPG, the blood pressure measures), respiratory, and temperature sensors. In our studies, we elicited emotions with films, pictures, speech preparation, and expressive writing. We studied a wide range of positive and negative emotions, including amusement, anger, disgust, excitement, fear, gratitude, sadness, tenderness, and threat. To the best of our knowledge, psychophysiology of positive and negative emotions (POPANE) database is the largest, consistent psychophysiological dataset on emotions ever collected and publicly shared. We hope that POPANE will provide individuals, companies, and laboratories with the data they need to perform their analyses, corroborate their results, and create robust psychophysiological models of emotions. The individuals data are openly available in POPANE dataset at https://data.psychosensing.psnc.pl/popane/index.html. " . "Subjective experience along with physiological activity are fundamental components of emotional responding. We present a publicly available dataset of psychophysiological responses to positive and negative emotions of 1157 healthy participants, collected across seven studies. In our studies were continuously recorded affect and physiological activity during resting baseline and emotional responding. We recorded physiological responses using electrocardiography (ECG), impedance cardiography (ICG), electrodermal activity (EDA), photoplethysmography (PPG, the blood pressure measures), respiratory, and temperature sensors. In our studies, we elicited emotions with films, pictures, speech preparation, and expressive writing. We studied a wide range of positive and negative emotions, including amusement, anger, disgust, excitement, fear, gratitude, sadness, tenderness, and threat. To the best of our knowledge, psychophysiology of positive and negative emotions (POPANE) database is the largest, consistent psychophysiological dataset on emotions ever collected and publicly shared. We hope that POPANE will provide individuals, companies, and laboratories with the data they need to perform their analyses, corroborate their results, and create robust psychophysiological models of emotions. The individuals data are openly available in POPANE dataset at https://data.psychosensing.psnc.pl/popane/index.html." . "application/ld+json" . . . . . . "https://w3id.org/ro-id/a415c54e-7d07-43c8-bcbe-1f76220f473f" . . "POPANE DATASET - Psychophysiology Of Positive And Negative Emotions" . . . . . . "Maciej Behnke. \"POPANE DATASET - Psychophysiology Of Positive And Negative Emotions.\" ROHub. Mar 11 ,2021. https://w3id.org/ro-id/a415c54e-7d07-43c8-bcbe-1f76220f473f." . . . "Biblio" . . . "Used" . . . "Metadata" . . . "Raw Data" . . . . . "Dataset" . . . "Produced" . . . "Data" . . . "Documentation" . . . . "https://data.psychosensing.psnc.pl/popane/index.html" . . "2022-03-24 13:25:06.838155+00:00" . "2022-03-24 13:25:07.593414+00:00" . "text/html" . . "https://data.psychosensing.psnc.pl/popane/index.html" . "2022-03-24 13:25:06.838155+00:00" . . . . . . . "service-account-generation-service" . . . "2026-05-19T13:47:29.180+02:00"^^ . . . . . "POPANE DATASET - Psychophysiology Of Positive And Negative Emotions" . "RSA" . "MIIBIjANBgkqhkiG9w0BAQEFAAOCAQ8AMIIBCgKCAQEAxszSDYX5tuCSkP7UiCtftYPFNQVTjgNu0I5fwdML2DLRDlp0xzmsQXRk8oHuvwGvG1aMjj6cpUqO+0rz2Sg/wvHOgUpkRH8VJXvmlkhafMLCMtUtk5JIx7e+fkzCby+fnmD7kMkGLrT+OaExWwEDmNlCAt0TPKcHSdwsjso2isXjtAsGevyCMke8ufnFYpjs746JES1eNzVnHnn2Kp/lqcm60GM+J8dLgRZp7fX0anW098xhKym6+xXFzqeju0vYRIHBPerv+r7skWxwk+a7Sd8msqVeYEv6NTqnyWvyWb6Yh8cvj04N6qm/T6C5FUPLQhzSaQgMVMU6yLqjPuu9DwIDAQAB" . "WRb4z3vYBIba1zKF54rT0bu/hRO59qI+IOJL6rzuTQw91P8GbKb5on9cnLfez05YCNKNmcKnZ7MkByx/VW5FIA1iy0BZ+MJb30O/fQHNV210fh+knTZQaNBvIi17ntsygiLYf3KDeG9AYlOYtsNsfaLiatvUT8uSeU/IWw29oiFAeQ8vNo+JzmNsB5+6CrWGvg8wBSO5Ubvv3gccqD9OfWU/XpbFT4b+6XEOBHhJiWGZAg08QQm4bsd/pmRpMt03KMD+0CN6j8LUjp6VtgDr0ESvsnjrDzIYT5eAbQjmcOsTEaWZIPoZadUdox/n8FqKQPk91S3dRFeE5NyzMVlzQw==" . . . . . . . "" . "Neurobiology" . . "https://w3id.org/ro-id/9bf840e3-7a39-41fc-be39-7eed9dc294db" . "2021-03-11T14:05:41.562+01:00" . "https://orcid.org/0000-0002-2455-4556" . . "https://w3id.org/ro-id/9bf840e3-7a39-41fc-be39-7eed9dc294db" . "2021-03-11T14:07:59.683+01:00" . "https://orcid.org/0000-0002-2455-4556" . . "https://w3id.org/ro-id/9bf840e3-7a39-41fc-be39-7eed9dc294db" . "2021-03-11T14:04:33.909+01:00" . "https://orcid.org/0000-0002-2455-4556" . . "http://sandbox.rohub.org/rodl/ROs/POPANE-1-fork/" . . . "psychology" . . "physiology" . . "popane dataset" . . "psychophysiology Of Positive" . . "medicine" . . "database" . . "data" . . "electrocardiography" . . "dataset" . . "neuropsychology" . . "DATASET" . . "impedance cardiography" . "Of Positive" . . . "emotion" . . "POPANE dataset" . . "studies" . . "psychophysiology of positive" . . "activity" . . "plethysmography" . "International Crisis Group" . . . "experience" . . "individual" . . "impedance cardiography" . . "emotions" . . "information" . . "response" . . "individuals data" . "Maciej Behnke" . . . "service-account-enrichment" . . . "http://sandbox.rohub.org/rodl/ROs/POPANE-1-snapshot-1/" . "http://sandbox.rohub.org/rodl/ROs/POPANE-1-snapshot-2/" . "http://sandbox.rohub.org/rodl/ROs/POPANE-1-snapshot/" . . . "8850"^^ . "https://api.rohub.org/api/ros/9bf840e3-7a39-41fc-be39-7eed9dc294db/crate/download/" . . "2021-03-11 12:48:21.251000+00:00" . "2025-03-05 01:14:11.720011+00:00" . "2021-03-11 12:48:21.251000+00:00" . "Subjective experience along with physiological activity are fundamental components of emotional responding. We present a publicly available dataset of psychophysiological responses to positive and negative emotions of 1157 healthy participants, collected across seven studies. In our studies were continuously recorded affect and physiological activity during resting baseline and emotional responding. We recorded physiological responses using electrocardiography (ECG), impedance cardiography (ICG), electrodermal activity (EDA), photoplethysmography (PPG, the blood pressure measures), respiratory, and temperature sensors. In our studies, we elicited emotions with films, pictures, speech preparation, and expressive writing. We studied a wide range of positive and negative emotions, including amusement, anger, disgust, excitement, fear, gratitude, sadness, tenderness, and threat. To the best of our knowledge, psychophysiology of positive and negative emotions (POPANE) database is the largest, consistent psychophysiological dataset on emotions ever collected and publicly shared. We hope that POPANE will provide individuals, companies, and laboratories with the data they need to perform their analyses, corroborate their results, and create robust psychophysiological models of emotions. The individuals data are openly available in POPANE dataset at https://data.psychosensing.psnc.pl/popane/index.html. " . "Subjective experience along with physiological activity are fundamental components of emotional responding. We present a publicly available dataset of psychophysiological responses to positive and negative emotions of 1157 healthy participants, collected across seven studies. In our studies were continuously recorded affect and physiological activity during resting baseline and emotional responding. We recorded physiological responses using electrocardiography (ECG), impedance cardiography (ICG), electrodermal activity (EDA), photoplethysmography (PPG, the blood pressure measures), respiratory, and temperature sensors. In our studies, we elicited emotions with films, pictures, speech preparation, and expressive writing. We studied a wide range of positive and negative emotions, including amusement, anger, disgust, excitement, fear, gratitude, sadness, tenderness, and threat. To the best of our knowledge, psychophysiology of positive and negative emotions (POPANE) database is the largest, consistent psychophysiological dataset on emotions ever collected and publicly shared. We hope that POPANE will provide individuals, companies, and laboratories with the data they need to perform their analyses, corroborate their results, and create robust psychophysiological models of emotions. The individuals data are openly available in POPANE dataset at https://data.psychosensing.psnc.pl/popane/index.html." . "application/ld+json" . . . . . . "https://w3id.org/ro-id/9bf840e3-7a39-41fc-be39-7eed9dc294db" . . "POPANE DATASET - Psychophysiology Of Positive And Negative Emotions" . . . . . . "Maciej Behnke. \"POPANE DATASET - Psychophysiology Of Positive And Negative Emotions.\" ROHub. Mar 11 ,2021. https://w3id.org/ro-id/9bf840e3-7a39-41fc-be39-7eed9dc294db." . "Data" . . . . . "Dataset" . . . "Produced" . . . "Metadata" . . . "Used" . . . "Raw Data" . . . "Documentation" . . . . . "Biblio" . . . . "https://data.psychosensing.psnc.pl/popane/index.html" . . "2021-03-11 12:48:21.251000+00:00" . "2022-03-24 13:25:15.335097+00:00" . "text/html" . . "https://data.psychosensing.psnc.pl/popane/index.html" . "2021-03-11 12:48:21.251000+00:00" . . . . . . . "service-account-generation-service" . . . "2026-05-19T13:47:28.863+02:00"^^ . . . . . "POPANE DATASET - Psychophysiology Of Positive And Negative Emotions" . "RSA" . "MIIBIjANBgkqhkiG9w0BAQEFAAOCAQ8AMIIBCgKCAQEAxszSDYX5tuCSkP7UiCtftYPFNQVTjgNu0I5fwdML2DLRDlp0xzmsQXRk8oHuvwGvG1aMjj6cpUqO+0rz2Sg/wvHOgUpkRH8VJXvmlkhafMLCMtUtk5JIx7e+fkzCby+fnmD7kMkGLrT+OaExWwEDmNlCAt0TPKcHSdwsjso2isXjtAsGevyCMke8ufnFYpjs746JES1eNzVnHnn2Kp/lqcm60GM+J8dLgRZp7fX0anW098xhKym6+xXFzqeju0vYRIHBPerv+r7skWxwk+a7Sd8msqVeYEv6NTqnyWvyWb6Yh8cvj04N6qm/T6C5FUPLQhzSaQgMVMU6yLqjPuu9DwIDAQAB" . "pWKzQSNm6riM8lPWJObqUyYGA3JzUpTR8+oAX/MoDseUoqDzgK8UPeeyLqBwXxoYwT5mpggpAPd09is2bOYJJn8XVnI9vSdiCpcm+TCnSZZY6s6i5VRt91V6sKqGJvR9toOBX7lxF75mPYJWfZ2KUjt+3BJOnQeKeXVcVWMnLudgFROMU6v39iQk0qow3mD+jgj4+opKTRktO5wGYApJT6bgh7ZEq0JNlQ0jh0TGuD8ksU5wh2pcnoqESG6vYaGE7/oebDMHO+O/8jhkGYeq1D4alyapLARluMsW9MIr4Vu0x1KtmP3opNkCaLVP7BDto9XEu8BFZMsbeAjLl9mNxg==" . . . . . . . "https://w3id.org/ro-id/acfec1a0-48af-48c3-9083-3c1969a31c21" . "2021-03-11T15:18:55.068+01:00" . "https://orcid.org/0000-0002-4704-6802" . . "https://w3id.org/ro-id/acfec1a0-48af-48c3-9083-3c1969a31c21" . "2021-03-11T14:49:03.095+01:00" . "https://orcid.org/0000-0002-2455-4556" . . "https://data.psychosensing.psnc.pl/popane/" . . . "physiology" . . "recorded affect" . . "dataset" . . "impedance cardiography" . . "activity" . "International Crisis Group" . . . "electrocardiography" . . "emotions" . . "Szymon KupiÅ?ski" . . . "service-account-enrichment" . . . "http://sandbox.rohub.org/rodl/ROs/POPANE-snapshot-1/" . "http://sandbox.rohub.org/rodl/ROs/POPANE-snapshot/" . . "8763"^^ . "https://api.rohub.org/api/ros/acfec1a0-48af-48c3-9083-3c1969a31c21/crate/download/" . . "2021-03-02 08:34:45.016000+00:00" . "2025-03-05 01:16:59.821378+00:00" . "2021-03-02 08:34:45.016000+00:00" . "Subjective experience along with physiological activity are fundamental components of emotional responding. We present a publicly available dataset of psychophysiological responses to positive and negative emotions of 1157 healthy participants, collected across seven studies. In our studies were continuously recorded affect and physiological activity during resting baseline and emotional responding. We recorded physiological responses using electrocardiography (EKG), impedance cardiography (ICG), electrodermal activity (EDA), photoplethysmography (PPG, the blood pressure measures), respiratory, and temperature sensors. In our studies, we elicited emotions with films, pictures, speech preparation, and expressive writing. We studied a wide range of positive and negative emotions, including: amusement, anger, disgust, excitement, fear, gratitude, sadness, tenderness, and threat. To the best of our knowledge, Psychophysiology of Positive and Negative Emotions (POPANE) database is the largest, consistent psychophysiological dataset on emotions ever collected and publicly shared. We hope that POPANE will provide individuals, companies, and laboratories with the data they need to perform their own analyses, corroborate their results, and create robust psychophysiological models of emotions." . "application/ld+json" . . . . . . "https://w3id.org/ro-id/acfec1a0-48af-48c3-9083-3c1969a31c21" . . "Psychophysiology of Positive and Negative Emotions (POPANE) – a dataset of over 1000 participants" . "database" . "dataset" . "electrocardiography" . "emotion" . "experience" . "individual" . "information" . "laboratory" . "participant" . "plethysmography" . "response" . "testing" . "environmental sciences" . "Biology" . "Medical procedure-test" . "Psychology" . "Science and technology" . "Psychophysiology of Positive and Negative Emotions" . "data" . "database" . "dataset" . "emotion" . "individual" . "participant" . "life sciences" . "available dataset" . "dataset of psychophysiological response" . "electrodermal activity" . "models of emotion" . "subjective experience" . "To the best of our knowledge, Psychophysiology of Positive and Negative Emotions (POPANE) database is the largest, consistent psychophysiological dataset on emotions ever collected and publicly shared." . "We hope that POPANE will provide individuals, companies, and laboratories with the data they need to perform their own analyses, corroborate their results, and create robust psychophysiological models of emotions." . "We present a publicly available dataset of psychophysiological responses to positive and negative emotions of 1157 healthy participants, collected across seven studies." . . . . . . "medicine" . "psychology" . "Szymon KupiÅ?ski. \"Psychophysiology of Positive and Negative Emotions (POPANE) – a dataset of over 1000 participants.\" ROHub. Mar 02 ,2021. https://w3id.org/ro-id/acfec1a0-48af-48c3-9083-3c1969a31c21." . "Data" . . . "Documentation" . . . "Metadata" . . . "Produced" . . . . . "Dataset" . . . . . "Biblio" . . . "Raw Data" . . . "Used" . . . . "https://data.psychosensing.psnc.pl/popane/" . . "2021-03-02 08:34:45.016000+00:00" . "2022-03-24 13:26:12.310038+00:00" . . "https://data.psychosensing.psnc.pl/popane/" . "2021-03-02 08:34:45.016000+00:00" . . . . . . . "service-account-generation-service" . . . "2026-05-19T13:47:25.969+02:00"^^ . . . . . "Psychophysiology of Positive and Negative Emotions (POPANE) – a dataset of over 1000 participants" . "RSA" . "MIIBIjANBgkqhkiG9w0BAQEFAAOCAQ8AMIIBCgKCAQEAxszSDYX5tuCSkP7UiCtftYPFNQVTjgNu0I5fwdML2DLRDlp0xzmsQXRk8oHuvwGvG1aMjj6cpUqO+0rz2Sg/wvHOgUpkRH8VJXvmlkhafMLCMtUtk5JIx7e+fkzCby+fnmD7kMkGLrT+OaExWwEDmNlCAt0TPKcHSdwsjso2isXjtAsGevyCMke8ufnFYpjs746JES1eNzVnHnn2Kp/lqcm60GM+J8dLgRZp7fX0anW098xhKym6+xXFzqeju0vYRIHBPerv+r7skWxwk+a7Sd8msqVeYEv6NTqnyWvyWb6Yh8cvj04N6qm/T6C5FUPLQhzSaQgMVMU6yLqjPuu9DwIDAQAB" . "GDlcqiDMHriTKltcOXm2rtJDG7/GQIswNumM8/ZdwpcKZ17OIj0AZFAW/6Tu8Dm73CDWdd2T7JOtO0rQ7z+QSq+e4Io1WEVPHFOBYY8eXuQAeoiqEwdsK9MRXWnpjEvxo/fx1M5oB9zRKqd1iUsyedoQQD4kC4gcuFx7ssnvghNTo1owB7Wb9VhhixtD8O0ZEfe5PTtuo2saSp4tZ5eVLY5z2cOs6O+PiknUJFemniuQnv5sCMAZYz4QYIeU65qRF2UOF+s4cTgFH3V9KZeX7kRFbyKNu2Ms4cTGnk5EqQplBbprKU7cVtayVfhom/b3t5omfzJJZA72gPUQxTdQrw==" . . . . . . . "" . "Ecology" . . . "galaxy climate" . . "botany" . . "tree size distribution" . . "FATES" . . "restart" . . "years" . . "year" . "Anne Fouilloux" . . . "simulation" . . "14.890016920473775" . "8.8" . "trees" . . "8.383233532934131" . "7.0" . "climate" . . "12.859560067681894" . "7.6" . "ecosystem" . . "7.7844311377245505" . "6.5" . "astrophysics" . . "100.0" . "0.3373451828956604" . "growth" . . "3.712574850299401" . "3.1" . "size distribution" . . "33.131067961165044" . "27.3" . "mannequin" . . "10.419161676646706" . "8.7" . "Hybrid run (started from a 300 year restart) of 5 years with the Functionally Assembled Terrestrial Ecosystem Simulator (FATES), a numerical terrestrial ecosystem model that simulates and predicts growth, death, and regeneration of plants and subsequent tree size distributions." . . "74.04809619238478" . "73.9" . "size" . . "4.910179640718562" . "4.1" . "year restart" . . "8.495145631067961" . "7.0" . "distribution" . . "15.905245346869712" . "9.4" . "reboot" . . "5.269461077844312" . "4.4" . "ecosystem model" . . "31.31067961165048" . "25.8" . "earth sciences" . . "100.0" . "0.9884166121482849" . "service-account-enrichment" . . . . . "56176"^^ . "https://api.rohub.org/api/ros/4086e5b7-284e-4551-a156-e3453ddcee58/crate/download/" . . "2021-01-12 07:48:50.406000+00:00" . "2025-03-05 00:45:33.066263+00:00" . "2021-01-12 07:48:50.406000+00:00" . "Hybrid run (started from a 300 year restart) of 5 years with the Functionally Assembled Terrestrial Ecosystem Simulator (FATES), a numerical terrestrial ecosystem model that simulates and predicts growth, death, and regeneration of plants and subsequent tree size distributions. The simulation has been done with Galaxy climate (https://climate.usegalaxy.eu/)" . "application/ld+json" . . . . "https://w3id.org/ro-id/4086e5b7-284e-4551-a156-e3453ddcee58" . "CWL" . "FATES" . "galaxy" . . "5 years CLM-FATES simulation for Nordic site ALP1 " . "5 years CLM-FATES simulation for Nordic site ALP1" . . . . . "https://w3id.org/ro-id/629864fb-93b2-4be3-a890-e9ea28e26493" . "https://w3id.org/ro-id/8fc73c90-ac1d-40bc-bdf8-59ae8363b776" . "https://w3id.org/ro-id/11991ee0-53b7-4075-a67e-6ff6d61cfe5b" . "https://w3id.org/ro-id/1a195447-3fd8-45b1-93e0-1339321e3e63" . "https://w3id.org/ro-id/208c7871-2339-4f65-9ddc-716c769a7ceb" . "https://w3id.org/ro-id/2a0be9f1-e45f-4386-a7d5-643d65a09f5c" . "https://w3id.org/ro-id/2db8a698-5133-4b98-a02b-56ea3e0531ad" . "https://w3id.org/ro-id/328147af-93a1-4f4d-b9cc-b1fb0d2c956e" . "https://w3id.org/ro-id/4876115a-30f5-4c0c-9ed0-e4b993bb5e77" . "https://w3id.org/ro-id/6ceb9abc-2027-4d4f-9d11-fd6eee62e7c3" . "https://w3id.org/ro-id/73b195e9-0df9-4eed-a2f4-c5312c5a0058" . "https://w3id.org/ro-id/ad5654a7-d821-469a-823f-01ae2ec8a40f" . "https://w3id.org/ro-id/bc50622e-2ffd-46e1-a3f1-4006bda7dfda" . "https://w3id.org/ro-id/d1bfec6d-2df9-4c37-8b1d-b1e55400d079" . "https://w3id.org/ro-id/403f8590-e78e-4479-85df-c7b3f53777ee" . "https://w3id.org/ro-id/b10c39dd-beb0-4370-91a0-113e7e549eb5" . "https://w3id.org/ro-id/4f4d5e03-8d3d-49bd-87c4-c16d018644b8" . "https://w3id.org/ro-id/73be0529-7ad3-4385-bf07-8e6897aad6be" . "https://w3id.org/ro-id/753d913e-550e-4c06-aefa-3a7f36d6c9e4" . "https://w3id.org/ro-id/d9f79a3c-9c3d-45b0-927e-264d19dc315b" . "https://w3id.org/ro-id/fe8c1ed6-1543-439e-9bd5-c31bc961f150" . "https://w3id.org/ro-id/0f0963bd-c886-44e6-9ff2-0be64e5f65ee" . "https://w3id.org/ro-id/1856bb10-e431-43a7-b980-1fd2ff4acd2d" . "https://w3id.org/ro-id/326afebf-7a12-4b1b-8dd5-624e45fe4289" . "https://w3id.org/ro-id/7ded6348-4362-4b43-9f93-357c6cb38a04" . "https://w3id.org/ro-id/9554adec-5201-4db9-9d2a-b519cd9ee0cc" . "https://w3id.org/ro-id/a6e3b2dd-1bcc-4025-b262-12d4156be3c3" . "https://w3id.org/ro-id/e87ad228-21df-4b77-acfe-c5ba67b102f1" . "https://w3id.org/ro-id/1c3ab0e6-20ee-4524-a616-d48e94cf7610" . "https://w3id.org/ro-id/8001189e-9a48-4e1c-8f57-a41d9e63e638" . "https://w3id.org/ro-id/29a12137-373b-4d46-a648-de00ea10519e" . "https://w3id.org/ro-id/2e933347-2e99-4257-a22b-af679de384c5" . "https://w3id.org/ro-id/3431e1a2-094f-41d0-a8e8-a83b19726915" . "https://w3id.org/ro-id/5733ed6b-ac53-4e4f-ba7d-e8d2e78ebfe7" . "https://w3id.org/ro-id/da620f27-9164-4279-bd9e-814de56eb258" . "https://w3id.org/ro-id/2bfc63ba-becf-4e5e-9659-beb0b2d97440" . "https://w3id.org/ro-id/4d1be4c6-ae8e-4d49-9f90-592f277faa6e" . "https://w3id.org/ro-id/b25440f9-f459-4080-acc4-7ee27ae80e0c" . "https://w3id.org/ro-id/87095d85-791a-427d-854a-873bbebfdd35" . "https://w3id.org/ro-id/af5b88b8-b48a-47c2-8534-6eeedc5a276a" . "https://w3id.org/ro-id/ee99313a-437c-4544-ad83-0be3ce0dbc72" . "Fouilloux, Anne. \"5 years CLM-FATES simulation for Nordic site ALP1 .\" ROHub. Jan 12 ,2021. https://w3id.org/ro-id/4086e5b7-284e-4551-a156-e3453ddcee58." . . "20149"^^ . "https://api.rohub.org/api/resources/38f14396-c1fd-478e-b5b2-135655b83783/download/" . . "2021-01-12 07:48:52+00:00" . "2022-03-24 13:26:32.864730+00:00" . "Galaxy Workflow" . . "CLM-FATES_ALP1_simulation_5years.ga" . "2021-01-12 07:48:52+00:00" . . . . . "3407"^^ . "https://api.rohub.org/api/resources/496190bd-ec8e-4d8f-a76b-77f61b82258d/download/" . . "2021-01-12 07:48:51.919000+00:00" . "2022-03-24 13:26:31.837948+00:00" . "Workflow in Common Workflow Language" . . "CLM-FATES_ALP1_simulation_5years.cwl" . "2021-01-12 07:48:51.919000+00:00" . . . . "42158"^^ . "https://api.rohub.org/api/resources/b7cf277d-f2e7-44e2-9e61-f6d67f8bb8aa/download/" . . "2021-04-29 14:26:54.977000+00:00" . "2022-03-24 13:26:29.832570+00:00" . "image/png" . . "Overview of FATES workflow for a single location in Norway" . "2021-04-29 14:26:54.977000+00:00" . . . . . . . "distribution" . . "10.538922155688624" . "8.8" . "5 years CLM-FATES simulation for Nordic site ALP1 ." . . "13.426853707414828" . "13.4" . "Weather" . . "Weather" . "Galaxy climate" . . "14.320388349514563" . "11.8" . "computer science" . . "67.79661016949152" . "4.0" . "climate" . . "8.982035928143713" . "7.5" . "fate" . . "6.347305389221557" . "5.3" . "Wireless technology" . . "Economy, business and finance/Economic sector/Computing and information technology/Wireless technology" . "Ecosystem" . . "Environment/Nature/Ecosystem" . "ALP1" . . "13.874788494077832" . "8.2" . "space sciences" . . "100.0" . "0.3373451828956604" . "5 years" . . "botany" . . "32.20338983050847" . "1.9" . "model" . . "14.890016920473775" . "8.8" . "regeneration" . . "14.213197969543147" . "8.4" . "simulation" . . "19.161676646706585" . "16.0" . "from a 300 year" . . "atmospheric sciences" . . "100.0" . "0.9884166121482849" . "The simulation has been done with Galaxy climate (https://climate.usegalaxy.eu/" . . "12.5250501002004" . "12.5" . "rebirth" . . "9.580838323353293" . "8.0" . "http" . . "4.910179640718562" . "4.1" . "Death and dying" . . "Society/Values/Death and dying" . "regeneration of plants" . . "12.742718446601941" . "10.5" . "Functionally Assembled Terrestrial Ecosystem Simulator" . . "13.367174280879864" . "7.9" . "of 5 years" . . "Industrial accident and incident" . . "Disaster, accident and emergency incident/Accident and emergency incident/Explosion accident and incident/Industrial accident and incident" . "service-account-generation-service" . . . "2026-05-19T13:47:25.617+02:00"^^ . . . . . "5 years CLM-FATES simulation for Nordic site ALP1" . "RSA" . "MIIBIjANBgkqhkiG9w0BAQEFAAOCAQ8AMIIBCgKCAQEAxszSDYX5tuCSkP7UiCtftYPFNQVTjgNu0I5fwdML2DLRDlp0xzmsQXRk8oHuvwGvG1aMjj6cpUqO+0rz2Sg/wvHOgUpkRH8VJXvmlkhafMLCMtUtk5JIx7e+fkzCby+fnmD7kMkGLrT+OaExWwEDmNlCAt0TPKcHSdwsjso2isXjtAsGevyCMke8ufnFYpjs746JES1eNzVnHnn2Kp/lqcm60GM+J8dLgRZp7fX0anW098xhKym6+xXFzqeju0vYRIHBPerv+r7skWxwk+a7Sd8msqVeYEv6NTqnyWvyWb6Yh8cvj04N6qm/T6C5FUPLQhzSaQgMVMU6yLqjPuu9DwIDAQAB" . "R+u6WllrNZOVnrscyXbmHkRRxvHIUb9Xs+hmCE/Len3LQenZGU9zbc/EdkLUvpBnehdsgyhwYW49K47Gg7xlpMrzlxtZ9bGyxQwURWgGg2OX71OoLiqTnBHV7FFPE96qPWrcAuuutLP7Mt5/fh77fwim9ijuH/i3d5d0ET4H/++FPluVzPM+PseJujvqqsPHcZhgohMg8jr8pRVyM9whnjvfCETeIM6xn0PndllWy32wKE9QtBLl8B/4jGQHWquZWlDdIhjJDzZbmz71ShrpQEWMDmmE0qjvllQm0y2SPEZbb4z071SM85wPTvKNcQ3lCBRSIN6O+RKgVhHt5YdH4w==" . . . . . . . . "agriculture" . . "home farming" . . "practices in the context" . . "use" . . "fertilizers" . "Esteban Gonz��lez" . . . "service-account-enrichment" . . . . "67072"^^ . "https://api.rohub.org/api/ros/a3f460ba-5e28-465f-9043-575ccc3692c1/crate/download/" . . "2021-01-11 02:30:21.779000+00:00" . "2025-03-05 00:55:14.657661+00:00" . "2021-01-11 02:30:21.779000+00:00" . "The project aims to understand and map the use of pesticides and fertilizers and sustainable alternative practices in the context of home farming and gardening. Simultaneously, it aims to disseminate information on the topic with the final aim of reducing the use of pesticides and fertilizers." . "application/ld+json" . . . . . . "https://w3id.org/ro-id/a3f460ba-5e28-465f-9043-575ccc3692c1" . . "In My Backyard" . "backyard" . "context" . "farming" . "fertiliser" . "horticulture" . "information" . "pesticide" . "practice" . "project" . "purpose" . "subject" . "use" . "earth sciences" . "Agriculture" . "Fertiliser" . "farming" . "fertilizer" . "gardening" . "pesticide" . "practice" . "project" . "topic" . "life sciences" . "alternative practice" . "final aim" . "home farming" . "information on the topic" . "use of pesticide" . "In My Backyard." . "Simultaneously, it aims to disseminate information on the topic with the final aim of reducing the use of pesticides and fertilizers." . "The project aims to understand and map the use of pesticides and fertilizers and sustainable alternative practices in the context of home farming and gardening." . . . . "agriculture" . "Esteban Gonz��lez. \"In My Backyard.\" ROHub. Jan 11 ,2021. https://w3id.org/ro-id/a3f460ba-5e28-465f-9043-575ccc3692c1." . . . "Dataset" . . . "Raw Data" . . . . . . "Documentation" . . . . . "Biblio" . . . "Used" . . . "Produced" . . . "Metadata" . . . . "Data" . . . "https://doi.org/10.5281/zenodo.4081597" . . "https://doi.org/10.5281/zenodo.4081585" . . "2021-01-11 02:30:21.779000+00:00" . "2022-03-24 13:26:50.237880+00:00" . . "In My Backyard: project reflections and take aways" . "2021-01-11 02:30:21.779000+00:00" . . . . . "https://doi.org/10.5281/zenodo.4081597" . . "2021-01-11 02:30:21.779000+00:00" . "2022-03-24 13:26:50.367381+00:00" . . "In My Backyard: project final report" . "2021-01-11 02:30:21.779000+00:00" . . . . . "61755"^^ . "https://api.rohub.org/api/resources/66bbddcb-e258-434f-a684-5361e6688032/download/" . . "2021-01-11 02:30:51.468000+00:00" . "2022-03-24 13:26:49.761269+00:00" . "image/png" . . "diagram-InMyBackyard.png" . "2021-01-11 02:30:51.468000+00:00" . . . . "https://doi.org/10.5281/zenodo.4081606" . . "https://doi.org/10.5281/zenodo.4081778" . . "2021-01-11 02:30:21.779000+00:00" . "2022-03-24 13:26:49.904734+00:00" . . "In My Backyard: On-Site Survey Responses Raw Dataset" . "2021-01-11 02:30:21.779000+00:00" . . . . "https://doi.org/10.5281/zenodo.4081597" . . "https://doi.org/10.5281/zenodo.4081606" . . "2021-01-11 02:30:21.779000+00:00" . "2022-03-24 13:26:50.093236+00:00" . . "In My Backyard: key insights" . "2021-01-11 02:30:21.779000+00:00" . . . . . . . "service-account-generation-service" . . . "2026-05-19T13:47:25.308+02:00"^^ . . . . . "In My Backyard" . "RSA" . "MIIBIjANBgkqhkiG9w0BAQEFAAOCAQ8AMIIBCgKCAQEAxszSDYX5tuCSkP7UiCtftYPFNQVTjgNu0I5fwdML2DLRDlp0xzmsQXRk8oHuvwGvG1aMjj6cpUqO+0rz2Sg/wvHOgUpkRH8VJXvmlkhafMLCMtUtk5JIx7e+fkzCby+fnmD7kMkGLrT+OaExWwEDmNlCAt0TPKcHSdwsjso2isXjtAsGevyCMke8ufnFYpjs746JES1eNzVnHnn2Kp/lqcm60GM+J8dLgRZp7fX0anW098xhKym6+xXFzqeju0vYRIHBPerv+r7skWxwk+a7Sd8msqVeYEv6NTqnyWvyWb6Yh8cvj04N6qm/T6C5FUPLQhzSaQgMVMU6yLqjPuu9DwIDAQAB" . "Ge72AU3Y95la44YE3bWtOovzvHa3zi5N9GIc99uzmUIazCOzVQAyBeAnFJlFEK/mnrXEuaE/AbHtVcL4j1d+8ZT+K6uHdpf6z79kKmyeoZdrIa3iAJqeUN57ubxYvxm2GQtVSB/NQcLlxfFubHmYXtvw7QNHjBgi+KrwE+sb3djJh6uc7rjWSlklYqkbdX70rYDeUXjZbgWx3HssUQXtWHav+kVcf2W9cl5EA+9KKCOgaIdY8wx5VC3h3EDOX1lwsa0d99LlvBqMlE0kB7Y8t2buZlNiprvDDQ/Tj1ALE/i82o88X0vPe/Yojk1cj4YvX7r+gyJXUuFSJUT8qslu+w==" . . . . . . . . "gain real time feedback of the data" . . "multimedia" . . "time and date" . . "hydrophone" . . "speaker" . . "hardware" . . "recording" . . "cost" . . "electronics" . "Esteban Gonz��lez" . . . "service-account-enrichment" . . . . "662879"^^ . "https://api.rohub.org/api/ros/e3d872de-a4bd-4803-bf31-5395d4748905/crate/download/" . . "2021-01-11 02:09:08.766000+00:00" . "2025-03-05 01:19:10.897816+00:00" . "2021-01-11 02:09:08.766000+00:00" . "The Sonic Kayak system is a low cost open hardware for gathering and mapping fine-scale marine environmental data, which has not been previously possible to obtain. Data is sonified through an onboard speaker allowing paddlers to seek out areas of interest and gain real time feedback of the data. The system currently includes underwater temperature sensors and a hydrophone for measuring underwater sound, each recording data every second with GPS, time and date." . "application/ld+json" . . . . . . . . . . "https://w3id.org/ro-id/e3d872de-a4bd-4803-bf31-5395d4748905" . . "Sonic Kayacs" . "amplifier" . "canoeist" . "cost" . "data" . "equipment" . "feedback" . "global positioning system" . "hydrophone" . "information" . "real time" . "sensor" . "temperature" . "time and date" . "earth sciences" . "Canoeing" . "Sonic Kayak" . "data" . "feedback" . "hydrophone" . "real time" . "sensor" . "speaker" . "engineering" . "Sonic Kayak system" . "real time feedback" . "recording data" . "temperature sensor" . "time and date" . "Data is sonified through an onboard speaker allowing paddlers to seek out areas of interest and gain real time feedback of the data." . "The Sonic Kayak system is a low cost open hardware for gathering and mapping fine-scale marine environmental data, which has not been previously possible to obtain." . "The system currently includes underwater temperature sensors and a hydrophone for measuring underwater sound, each recording data every second with GPS, time and date." . . . . "computer science" . "electronics" . "Esteban Gonz��lez. \"Sonic Kayacs.\" ROHub. Jan 11 ,2021. https://w3id.org/ro-id/e3d872de-a4bd-4803-bf31-5395d4748905." . . . "Biblio" . . . "Metadata" . . . "Raw Data" . . . "Used" . . . . . "Device" . . . . . "Data" . . . . . "Dataset" . . . "Produced" . . . . . "Dissemination" . . . . . . "Documentation" . . . . . "594964"^^ . "https://api.rohub.org/api/resources/1a799453-ca28-41fa-963f-eb323f6c722d/download/" . . "2021-01-11 02:14:55.977000+00:00" . "2022-03-24 13:27:07.750442+00:00" . "image/png" . . "full-wiring-action.png" . "2021-01-11 02:14:55.977000+00:00" . . . . . "https://doi.org/10.5281/zenodo.3923743" . . "2021-01-11 02:09:08.766000+00:00" . "2022-03-24 13:27:08.698797+00:00" . . "Sonic Kayak survey" . "2021-01-11 02:09:08.766000+00:00" . . . . "https://github.com/fo-am/sonic-kayaks/wiki" . . "https://doi.org/10.5281/zenodo.4041588" . . "2021-01-11 02:09:08.766000+00:00" . "2022-03-24 13:27:08.225461+00:00" . "Dataset generated for the device" . . "Measurements" . "2021-01-11 02:09:08.766000+00:00" . . . . . "95539"^^ . "https://api.rohub.org/api/resources/424544a5-6157-4d09-ad73-5e3ac1f9d2cf/download/" . . "2021-01-11 02:09:44.849000+00:00" . "2022-03-24 13:27:06.391281+00:00" . "image/png" . . "diagram-sonickayacs.png" . "2021-01-11 02:09:44.849000+00:00" . . . . . "https://magpi.raspberrypi.org/issues/97/pdf" . . "2021-01-11 02:09:08.766000+00:00" . "2022-03-24 13:27:08.042715+00:00" . "Magazine with an article describing the device" . . "The MagPi — Issue 97" . "2021-01-11 02:09:08.766000+00:00" . . . . . "https://www.flickr.com/photos/foam/albums/72157715979200366" . . "2021-01-11 02:09:08.766000+00:00" . "2022-03-24 13:27:08.589186+00:00" . . "Sonic Kayak data visualisations" . "2021-01-11 02:09:08.766000+00:00" . . . . "https://doi.org/10.5281/zenodo.3923743" . . "https://fo.am/blog/2020/08/17/sonic-kayak-update-new-sensors-sonifications-and-visualisations/" . . "2021-01-11 02:09:08.766000+00:00" . "2022-03-24 13:27:08.480939+00:00" . . "Sonic Kayak update - new sensors, sonifications, and visualisations" . "2021-01-11 02:09:08.766000+00:00" . . . . . "https://github.com/fo-am/sonic-kayaks/raw/master/hardware/full-wiring-action.png" . . "2021-01-11 02:09:08.766000+00:00" . "2022-03-24 13:27:06.600078+00:00" . "image/png" . . "https://github.com/fo-am/sonic-kayaks/raw/master/hardware/full-wiring-action.png" . "2021-01-11 02:09:08.766000+00:00" . . . . . "https://www.youtube.com/watch?v=puLXKj1AVAk" . . "2021-01-11 02:09:08.766000+00:00" . "2022-03-24 13:27:08.915023+00:00" . . "Sonic Kayaks - citizen science in the marine environment for the ACTION project" . "2021-01-11 02:09:08.766000+00:00" . . . . . "https://fo.am/blog/2020/06/30/sonic-kayak-environmental-data-sonification/" . . "2021-01-11 02:09:08.766000+00:00" . "2022-03-24 13:27:08.374657+00:00" . "Sonic Kayaks are rigged with sensors, both underwater (temperature, sound, and turbidity) and above water (air pollution). As the kayaker paddles around, the sensors pick up changes in the environment, and these are played to the kayaker in real time through an on-board speaker. Originally this approach came from a sound art project (Kaffe Matthews’ Sonic Bikes), but we realised it could also be useful for researchers to be able to follow data or seek out particular environments through sound, and along the way we gathered interest from the visually impaired community for using the sounds to augment their kayaking experience or guide navigation on the water." . . "Sonic Kayak environmental data sonification" . "2021-01-11 02:09:08.766000+00:00" . . . . "https://doi.org/10.5281/zenodo.3923743" . . "https://fo.am/blog/2020/05/05/sonic-kayak-progress-new-pollution-sensors-for-citizen-science/" . . "2021-01-11 02:09:08.766000+00:00" . "2022-03-24 13:27:08.806456+00:00" . . "Sonic Kayak progress – new pollution sensors for citizen science" . "2021-01-11 02:09:08.766000+00:00" . . . . . "https://github.com/fo-am/sonic-kayaks/wiki" . . "2021-01-11 02:09:08.766000+00:00" . "2022-03-24 13:27:06.743586+00:00" . "This wiki documents the hardware and software used in the current Sonic Kayaks setup." . . "Sonic Kayacs Wiring Schematic: Water and Air Pollution Edition" . "2021-01-11 02:09:08.766000+00:00" . . . . . "https://w3id.org/ro-id/e3d872de-a4bd-4803-bf31-5395d4748905/full-wiring-action.png" . . . . "service-account-generation-service" . . . "2026-05-19T13:47:24.996+02:00"^^ . . . . . "Sonic Kayacs" . "RSA" . "MIIBIjANBgkqhkiG9w0BAQEFAAOCAQ8AMIIBCgKCAQEAxszSDYX5tuCSkP7UiCtftYPFNQVTjgNu0I5fwdML2DLRDlp0xzmsQXRk8oHuvwGvG1aMjj6cpUqO+0rz2Sg/wvHOgUpkRH8VJXvmlkhafMLCMtUtk5JIx7e+fkzCby+fnmD7kMkGLrT+OaExWwEDmNlCAt0TPKcHSdwsjso2isXjtAsGevyCMke8ufnFYpjs746JES1eNzVnHnn2Kp/lqcm60GM+J8dLgRZp7fX0anW098xhKym6+xXFzqeju0vYRIHBPerv+r7skWxwk+a7Sd8msqVeYEv6NTqnyWvyWb6Yh8cvj04N6qm/T6C5FUPLQhzSaQgMVMU6yLqjPuu9DwIDAQAB" . "ewi5aSu4uqVthWWwT83Mgqi8ceDLkcv4Fahwi7Co0QgbSaI1mzSPQT9JvlPQp4RPz9LC5lCaYyk45zhkSShI2q5YngSm2QW5wkQh4okOLlbYUj0hQDGe+/JP+knI/QptygvZbKKkjD3tILBuf32pHRp80QNrvEwZAzejGKRKHsNBOSAfX5MGEMh+Fuqcs3WFTmAUqlVYf3Ixlym8cxBmeIyIhtKYht33mDIkFlcm0HS5h72KGAjUH2DypB3n1lqHOPyGuTzuRLEORlF7w8kPmtFuaBPqHnkhI9XmdjV0N1ucjxUTjx8EoxAQeQ9gvEduiIH0yZ/yeKyBs8m+4+1uBw==" . . . . . . . . "maps noise map" . . "empower community" . . "Maps" . . "Noise" . . "heritage" . . "folklore" . "Esteban Gonz��lez" . . . "service-account-enrichment" . . . . "135152"^^ . "https://api.rohub.org/api/ros/54e02cd6-ee8c-4d6d-af46-c7421de99997/crate/download/" . . "2020-11-25 09:14:49.401000+00:00" . "2025-03-05 02:45:35.165781+00:00" . "2020-11-25 09:14:49.401000+00:00" . "NOISE MAPS allows citizens to generate and analyse urban sound data, empowering communities to take action to reduce unwanted noise and protect the local sonic heritage. The pilot builds on existing cultural practices of collective documentation of the sound heritage of neighbourhoods (Mapa Sonor). Thanks to project activities citizens will be able to filter unwanted noise out from authentic, locally unique sounds, thus allowing communities to take action to preserve their sonic heritage. NOISE MAPS deploys a combination of tested tech and methods with a novel approach, to empower communities to leverage the power of citizen science to tackle local challenges of global relevance." . "application/ld+json" . . . . . . "https://w3id.org/ro-id/54e02cd6-ee8c-4d6d-af46-c7421de99997" . . "Noise Maps" . "activity" . "citizen" . "combination" . "community" . "documentation" . "engineering" . "heritage" . "information" . "noise" . "pilot" . "practice" . "quarter" . "environmental sciences" . "Customs and tradition" . "MAPS" . "citizen" . "community" . "heritage" . "noise" . "pilot" . "practice" . "life sciences" . "combination of tested tech" . "noise MAPS" . "project activities citizen" . "sound heritage" . "unwanted noise" . "NOISE MAPS allows citizens to generate and analyse urban sound data, empowering communities to take action to reduce unwanted noise and protect the local sonic heritage." . "NOISE MAPS deploys a combination of tested tech and methods with a novel approach, to empower communities to leverage the power of citizen science to tackle local challenges of global relevance." . "The pilot builds on existing cultural practices of collective documentation of the sound heritage of neighbourhoods (Mapa Sonor) Thanks to project activities citizens will be able to filter unwanted noise out from authentic, locally unique sounds, thus allowing communities to take action to preserve their sonic heritage." . . . . . "sociology" . "Esteban Gonz��lez. \"Noise Maps.\" ROHub. Nov 25 ,2020. https://w3id.org/ro-id/54e02cd6-ee8c-4d6d-af46-c7421de99997." . . "Software" . . . . "Raw_Data" . . . . "Datasets" . . . . . "Dissemination" . . . . "https://freesound.org/people/bitlab_coop/packs/" . "https://github.com/pzinemanas/AudioMoth-Firmware-SPL" . "2020-11-25 09:14:49.401000+00:00" . "2022-03-24 13:27:28.032478+00:00" . . "Sounds recorded" . "2020-11-25 09:14:49.401000+00:00" . . . . "https://ars.electronica.art/keplersgardens/en/sonic-heritage/" . . "2020-11-25 09:14:49.401000+00:00" . "2022-03-24 13:27:28.365817+00:00" . . "Ars Electronica - Sonic Heritage" . "2020-11-25 09:14:49.401000+00:00" . . . . . "https://github.com/pzinemanas/AudioMoth-Firmware-SPL" . . "2020-11-25 09:14:49.401000+00:00" . "2022-03-24 13:27:28.439176+00:00" . . "https://github.com/pzinemanas/AudioMoth-Firmware-SPL" . "2020-11-25 09:14:49.401000+00:00" . . . . "138785"^^ . "https://api.rohub.org/api/resources/d4898e2f-704f-407d-b143-d8a16f981950/download/" . . "2020-11-25 09:15:52.369000+00:00" . "2022-03-24 13:27:27.751199+00:00" . "image/png" . . "diagram-noisemaps.png" . "2020-11-25 09:15:52.369000+00:00" . . . . . "https://ars.electronica.art/keplersgardens/en/what-is-noise/" . . "2020-11-25 09:14:49.401000+00:00" . "2022-03-24 13:27:28.214158+00:00" . . "Ars Electronica - What is noise" . "2020-11-25 09:14:49.401000+00:00" . . . . . "https://doi.org/10.5281/zenodo.4059533" . . "2020-11-25 09:14:49.401000+00:00" . "2022-03-24 13:27:27.896482+00:00" . . "Noise Maps ACTION pilot data 2020" . "2020-11-25 09:14:49.401000+00:00" . . . . . . . "service-account-generation-service" . . . "2026-05-19T13:47:24.660+02:00"^^ . . . . . "Noise Maps" . "RSA" . "MIIBIjANBgkqhkiG9w0BAQEFAAOCAQ8AMIIBCgKCAQEAxszSDYX5tuCSkP7UiCtftYPFNQVTjgNu0I5fwdML2DLRDlp0xzmsQXRk8oHuvwGvG1aMjj6cpUqO+0rz2Sg/wvHOgUpkRH8VJXvmlkhafMLCMtUtk5JIx7e+fkzCby+fnmD7kMkGLrT+OaExWwEDmNlCAt0TPKcHSdwsjso2isXjtAsGevyCMke8ufnFYpjs746JES1eNzVnHnn2Kp/lqcm60GM+J8dLgRZp7fX0anW098xhKym6+xXFzqeju0vYRIHBPerv+r7skWxwk+a7Sd8msqVeYEv6NTqnyWvyWb6Yh8cvj04N6qm/T6C5FUPLQhzSaQgMVMU6yLqjPuu9DwIDAQAB" . "sovzjCofPdBS+E7DlF4odSgN0UsJ55Foy/nKInU/MD7GL4QXvYOwqMUbUZi+RstN6Rfk6U8tsQPXy1yYoPxyOiww0b9pEmWzTOyJaCFt40Q3+iHrrk/2gWV4VjYN9prP5xFeHbTpoIIWEEYzuPPZjE0F4YZsucYjRlAwoKbEYPA2qqOWQAkKQ5anwqytQq3sRiFJ5JHrvx63VYy8k3TMfs33kCDmRTX8iSuo1zZS7xM26Vonz4LYsaqPiGCyd5ahsICm0zREL0iGfCx5fFJnQhdDfRfcCIWWXwYLKw4sf3/4OKLE+xAByG3e+ISzP+MxaAVaXjlyuue68+qq4Uqo5g==" . . . . . . . . "Nordic country" . . "ecology" . . "air pollution in schools Norway" . . "Oslo" . . "electric cars" . . "Oslo" . . "air quality" . . "pilot" . . "ACTION" . "Esteban González+Guardia" . . . "High schools" . . "Education/School/High schools" . "sensor platform" . . "49.447077409162716" . "31.3" . "high school" . . "6.68859649122807" . "6.1" . "student" . . "8.333333333333334" . "7.6" . "Oslo" . . "11.764705882352942" . "6.0" . "electric car" . . "13.92156862745098" . "7.1" . "project" . . "3.6184210526315788" . "3.3" . "Air pollution" . . "Environment/Environmental pollution/Air pollution" . "Oslo" . . "https://www.wikidata.org/wiki/Q585" . "Oslo" . . "8.552631578947368" . "7.8" . "atmospheric sciences" . . "100.0" . "0.6394369006156921" . "earth sciences" . . "100.0" . "0.6394369006156921" . "information" . . "4.166666666666667" . "3.8" . "pilot of the action project" . . "7.266982622432858" . "4.6" . "air quality project" . . "24.170616113744074" . "15.3" . "PM10" . . "7.2368421052631575" . "6.6" . "electric car" . . "10.087719298245613" . "9.2" . "ecology" . . "100.0" . "13.0" . "air pollution" . . "14.117647058823529" . "7.2" . "We use the Nova SDS011 sensor for measuring PM2.5 and PM10 that is transmitting data to an Arduino board." . . "24.727272727272727" . "13.6" . "engineering" . . "100.0" . "0.7565824389457703" . "PM10" . . "10.392156862745098" . "5.3" . "air pollution" . . "10.197368421052632" . "9.3" . "By actively promoting the purchase of electric cars, the Norwegian government is aiming at protecting the environment and not least improving air quality, especially in urban areas." . . "30.90909090909091" . "17.0" . "air quality" . . "26.274509803921568" . "13.4" . "service-account-enrichment" . . . . "202135"^^ . "https://api.rohub.org/api/ros/b04c829e-997d-44e6-8ef2-5893622403d2/crate/download/" . . "2020-11-03 17:22:37.815000+00:00" . "2025-03-05 00:45:35.558116+00:00" . "2020-11-03 17:22:37.815000+00:00" . "Norway is the land of fjords, trolls and – electric cars. By actively promoting the purchase of electric cars, the Norwegian government is aiming at protecting the environment and not least improving air quality, especially in urban areas. Air quality is still a reason for concern in many European countries, including the Nordic countries. Not many people are aware of this fact, and this is where the Norwegian pilot of the ACTION project comes in.The pilot gives high school students in Oslo and the larger Oslo area the opportunity to design and carry out their own air quality projects, using an off-the-shelf air quality sensor platform. The aim is to create awareness about the sources of air pollution, make the students think of ways to reduce both emission and exposure and teach them scientific working methods. We use the Nova SDS011 sensor for measuring PM2.5 and PM10 that is transmitting data to an Arduino board. The data can be obtained through an SD card." . "application/ld+json" . . . . . . . . . . "https://w3id.org/ro-id/b04c829e-997d-44e6-8ef2-5893622403d2" . . "ACTION - Air Pollution in Schools" . . . . "https://w3id.org/ro-id/628c2aeb-5036-4192-95c0-11fead761441" . "https://w3id.org/ro-id/37394f65-575e-41f1-9c3b-8886317b9379" . "https://w3id.org/ro-id/bdb8e64c-d4c8-41ba-95a3-d43005c062b7" . "https://w3id.org/ro-id/10de924a-94ca-4126-bf32-847de386f7a4" . "https://w3id.org/ro-id/128b085e-0ab8-404d-9a66-c90d6ae05e90" . "https://w3id.org/ro-id/2e2e97a5-493c-49cd-b0b0-26763a4dbd8c" . "https://w3id.org/ro-id/3fc4bb19-f881-48b8-a8ff-c400e2f78171" . "https://w3id.org/ro-id/49e46db1-78f3-40bc-a454-8027f4e7168a" . "https://w3id.org/ro-id/583ae044-ba1c-4302-b34d-8451107e6de4" . "https://w3id.org/ro-id/58c9fa1d-994b-42e5-a662-32d05cda9be1" . "https://w3id.org/ro-id/85077b7a-4107-406f-a23e-8b6775c00af5" . "https://w3id.org/ro-id/b2e63529-710c-47ff-8fd7-8ce2718e0088" . "https://w3id.org/ro-id/d133904e-b935-4a36-ad0f-a60d3baa1451" . "https://w3id.org/ro-id/ec4cd90d-be2b-457e-a49a-bc77d729aa5f" . "https://w3id.org/ro-id/ee74f830-35df-41e4-b9ae-0f731ab41038" . "https://w3id.org/ro-id/ef8a303d-1d19-4b73-b0f6-66c1dcbb9977" . "https://w3id.org/ro-id/4128512f-df8d-465e-9eef-4f92af23a5a7" . "https://w3id.org/ro-id/4219f70b-3a6f-4cd1-b0db-7f9ddbec5f15" . "https://w3id.org/ro-id/07fe7d14-d4bf-4540-b8f9-c5691f488d62" . "https://w3id.org/ro-id/34bbfc83-4b45-4f51-8011-d46bcb83c955" . "https://w3id.org/ro-id/ef8b75da-19d0-43d7-a2ff-bb06c52d9cae" . "https://w3id.org/ro-id/1b45fcec-bd5c-4d73-8f91-a5ff895651d5" . "https://w3id.org/ro-id/2ae05b14-ac5f-4e55-9446-0b3fcbec1912" . "https://w3id.org/ro-id/6564fc22-9a8b-4a3e-925c-bc4ab6c59c1d" . "https://w3id.org/ro-id/827ca094-21bf-4063-93b7-b31122508431" . "https://w3id.org/ro-id/9d58dbb8-102c-4217-8d03-e34cba02385a" . "https://w3id.org/ro-id/c48d970f-ec65-4bda-be91-cc2872842314" . "https://w3id.org/ro-id/e8eb655a-bc33-4705-9392-fb1a92c20095" . "https://w3id.org/ro-id/778c2726-c900-459c-a44b-2161059c95ae" . "https://w3id.org/ro-id/e61b5bb9-7e0f-45f3-95e4-12a9a150b1de" . "https://w3id.org/ro-id/0df21445-75d3-44dc-b745-8892f3b14578" . "https://w3id.org/ro-id/4f025fd9-55b7-4534-833f-7eb416e8c2ac" . "https://w3id.org/ro-id/54bcf67c-d704-4844-93c8-445166d183af" . "https://w3id.org/ro-id/e996a0c6-3624-4e6e-9214-be26a38e613b" . "https://w3id.org/ro-id/ffe8406d-7011-4880-9a1f-d85467d6e39f" . "https://w3id.org/ro-id/72402c2b-9c74-4ad5-8cde-067dd154cf3f" . "https://w3id.org/ro-id/87648c4f-b7dc-4884-a6f2-93be7336f0a0" . "https://w3id.org/ro-id/ef99ba9f-8142-4cc1-a9af-ccf44ac6996e" . "Esteban González+Guardia. \"ACTION - Air Pollution in Schools.\" ROHub. Nov 03 ,2020. https://w3id.org/ro-id/b04c829e-997d-44e6-8ef2-5893622403d2." . "Documentation" . . . . . "Biblio" . . . . . "Teaching_Material" . . . "Produced" . . . . . "Dataset" . . . . "Deliverables" . . . "Metadata" . . . . . . "Raw Data" . . . . "Hardware" . . . . . . . . . . . "Presentations" . . . "Used" . . . "Data" . . . . "https://zenodo.org/record/3737595#.X6GVelNKi8o" . . "2020-11-03 17:22:37.815000+00:00" . "2022-03-24 13:28:31.216813+00:00" . . "Systematiske mÃ¥linger: Bilfritt sentrum og virkningen av denne" . "2020-11-03 17:22:37.815000+00:00" . . . . . "195381"^^ . "https://api.rohub.org/api/resources/2fdf70df-0dad-4b06-a941-710579f0bfd0/download/" . . "2020-11-03 17:23:51.299000+00:00" . "2022-03-24 13:28:29.878147+00:00" . "image/png" . . "research-object-nilu.png" . "2020-11-03 17:23:51.299000+00:00" . . . . . "https://zenodo.org/record/3737799#.X6GSnVNKi8o" . "https://doi.org/10.5281/zenodo.3956481" . "2020-11-03 17:22:37.815000+00:00" . "2022-03-24 13:28:30.158519+00:00" . . "DATALOG_Lambertseter_VGS_20190329_Sensor_2" . "2020-11-03 17:22:37.815000+00:00" . . . . . "https://zenodo.org/record/3730478#.X6GUGFNKi8o" . . "2020-11-03 17:22:37.815000+00:00" . "2022-03-24 13:28:30.725184+00:00" . . "Forskningsprosjekt luftforurensning" . "2020-11-03 17:22:37.815000+00:00" . . . . . "https://zenodo.org/record/3737595#.X6GVqlNKi8o" . . "2020-11-03 17:22:37.815000+00:00" . "2022-03-24 13:28:31.359856+00:00" . . "Systematiske mÃ¥linger: Bilfritt sentrum og virkningen av denne" . "2020-11-03 17:22:37.815000+00:00" . . . . "NOVA SDS011 Sensor" . . "https://zenodo.org/record/3956481#.X6GWeVNKi8o" . . "2020-11-03 17:22:37.815000+00:00" . "2022-03-24 13:28:32.083544+00:00" . . "RDUINO_UNO_WITH_NOVASDS011_Firmware" . "2020-11-03 17:22:37.815000+00:00" . . . . . "https://zenodo.org/record/3737565#.X6GWPVNKi8o" . . "2020-11-03 17:22:37.815000+00:00" . "2022-03-24 13:28:31.940094+00:00" . . "Er luftkvalitaten ved Ullern VGS skadelig for elevene?" . "2020-11-03 17:22:37.815000+00:00" . . . . . "https://zenodo.org/record/3737759#.X6GSQFNKi8o" . "https://zenodo.org/record/3956481#.X6GXUFNKi8o" . "2020-11-03 17:22:37.815000+00:00" . "2022-03-24 13:28:30.218641+00:00" . . "DATALOG_Lambertseter_VGS_20190329" . "2020-11-03 17:22:37.815000+00:00" . . . . . "https://zenodo.org/record/3737799" . "https://zenodo.org/record/3737759" . "2020-11-03 17:22:37.815000+00:00" . "2022-03-24 13:28:32.467392+00:00" . . "DATALOG" . "2020-11-03 17:22:37.815000+00:00" . . . . . "https://zenodo.org/record/3730465#.X6GTTFNKi8o" . . "2020-11-03 17:22:37.815000+00:00" . "2022-03-24 13:28:30.595340+00:00" . . "Air Pollution Perception in Public Participation" . "2020-11-03 17:22:37.815000+00:00" . . . . . "https://zenodo.org/record/3737635#.X6GUj1NKi8o" . . "2020-11-03 17:22:37.815000+00:00" . "2022-03-24 13:28:30.880503+00:00" . . "Trafikkforurensing: Trafikkerte omrÃ¥der er mer utsatt for forurensing" . "2020-11-03 17:22:37.815000+00:00" . . . . . "https://zenodo.org/record/3737577#.X6GV-VNKi8o" . . "2020-11-03 17:22:37.815000+00:00" . "2022-03-24 13:28:31.639184+00:00" . . "Luftkvalitet: Andel svevestøv i lufta øker ved rushtiden" . "2020-11-03 17:22:37.815000+00:00" . . . . . "https://zenodo.org/record/3730457#.X6GTGVNKi8o" . . "2020-11-03 17:22:37.815000+00:00" . "2022-03-24 13:28:30.458800+00:00" . . "Tutorial for air quality projects in high schools" . "2020-11-03 17:22:37.815000+00:00" . . . . . "https://zenodo.org/record/3737569#.X6GWGVNKi8o" . . "2020-11-03 17:22:37.815000+00:00" . "2022-03-24 13:28:31.787207+00:00" . . "Hvordan utvikler luftkvaliteten i et klasserom seg?" . "2020-11-03 17:22:37.815000+00:00" . . . . . "https://zenodo.org/record/3737608#.X6GVUFNKi8o" . . "2020-11-03 17:22:37.815000+00:00" . "2022-03-24 13:28:31.020395+00:00" . . "Systematiske mÃ¥linger: Vi ønsker Ã¥ finne ut om det akustiske miljøet har effekt pÃ¥ luftkvalitetens endringer" . "2020-11-03 17:22:37.815000+00:00" . . . . . "https://zenodo.org/record/3737589#.X6GV0FNKi8o" . . "2020-11-03 17:22:37.815000+00:00" . "2022-03-24 13:28:31.504178+00:00" . . "Optimalt arbeidsmiljø: systematiske mÃ¥linger av støy og temperatur i klasserom, og sammenhengem mellom dem" . "2020-11-03 17:22:37.815000+00:00" . . . . . . . "air quality" . . "18.750000000000004" . "17.1" . "Norway" . . "https://www.wikidata.org/wiki/Q20" . "sensor" . . "12.156862745098039" . "6.2" . "data" . . "4.934210526315789" . "4.5" . "instrumentation and photography" . . "100.0" . "0.7565824389457703" . "student" . . "11.372549019607844" . "5.8" . "in.the pilot" . . "10.584518167456554" . "6.7" . "pilot" . . "4.714912280701754" . "4.3" . "opportunity" . . "3.837719298245614" . "3.5" . "sensor" . . "8.881578947368421" . "8.1" . "Students" . . "Education/Teaching and learning/Students" . "Not many people are aware of this fact, and this is where the Norwegian pilot of the ACTION project comes in.The pilot gives high school students in Oslo and the larger Oslo area the opportunity to design and carry out their own air quality projects, using an off-the-shelf air quality sensor platform." . . "44.36363636363637" . "24.4" . "air pollution in school" . . "8.530805687203792" . "5.4" . "service-account-generation-service" . . . "2026-05-19T13:47:24.108+02:00"^^ . . . . . "ACTION - Air Pollution in Schools" . "RSA" . "MIIBIjANBgkqhkiG9w0BAQEFAAOCAQ8AMIIBCgKCAQEAxszSDYX5tuCSkP7UiCtftYPFNQVTjgNu0I5fwdML2DLRDlp0xzmsQXRk8oHuvwGvG1aMjj6cpUqO+0rz2Sg/wvHOgUpkRH8VJXvmlkhafMLCMtUtk5JIx7e+fkzCby+fnmD7kMkGLrT+OaExWwEDmNlCAt0TPKcHSdwsjso2isXjtAsGevyCMke8ufnFYpjs746JES1eNzVnHnn2Kp/lqcm60GM+J8dLgRZp7fX0anW098xhKym6+xXFzqeju0vYRIHBPerv+r7skWxwk+a7Sd8msqVeYEv6NTqnyWvyWb6Yh8cvj04N6qm/T6C5FUPLQhzSaQgMVMU6yLqjPuu9DwIDAQAB" . "GRRD6kXX3Jt+aiJDSqbumNVguHo5cx3ApO3wFAjrkE7ZZO2Q9t6MLiCxCQC54+o1KRrixad8c3qR7igtEsPXwWkDvyuMBwEacsUQLxzXg1oGHuEgFmFXHbzXKC4xWJScwCBo2ucBKiC2yR2luQtV+BoZvpcOkODhe5kxKPjgq89Ky4T1gL1KzKXGSW8Awg47WX8nRGG1miEPdC3BZI9mZVliD4zp+i9f4Ul1ykTCd5wbp4/OmdAe5Cv+6rbYAyjAtqfQJJZeW9xgFh02mHdoOctG/GfEQG4sxX3PrzSnmQVdqi5cfiI/P63Et1tfFjev31HFn6V5XwKxCAts/W8eUA==" . . . . . . . "Antonio Petrizzo" . . "http://sandbox.rohub.org/rodl/ROs/sinktrack_FORK/" . "Matlab, Taverna, Linux environment" . . . "http://w3id.org/ro-id/rohub/model#change_specifications/5ef61e03-1c33-483b-9abc-e527bc6ab6be/changes/23e62dba-df50-4485-a4f5-2e508a712418" . "http://w3id.org/ro-id/rohub/model#change_specifications/5ef61e03-1c33-483b-9abc-e527bc6ab6be/changes/332cb24b-df2a-4235-b600-51b78ea934f5" . "http://w3id.org/ro-id/rohub/model#change_specifications/5ef61e03-1c33-483b-9abc-e527bc6ab6be/changes/37692d3f-0fea-4dd1-ad7b-ec8da1aca48a" . "http://w3id.org/ro-id/rohub/model#change_specifications/5ef61e03-1c33-483b-9abc-e527bc6ab6be/changes/3a10914c-23cb-4be9-b7cc-880d8c97dd25" . "http://w3id.org/ro-id/rohub/model#change_specifications/5ef61e03-1c33-483b-9abc-e527bc6ab6be/changes/408afda8-85ab-4b04-9705-0fcaa16cb98d" . "http://w3id.org/ro-id/rohub/model#change_specifications/5ef61e03-1c33-483b-9abc-e527bc6ab6be/changes/ca895d77-7f18-46a5-aac8-0b0580021094" . . "https://box.everest.psnc.pl/f/2a521bb3de8345b1ae9b/" . . . "https://box.everest.psnc.pl/f/2a521bb3de8345b1ae9b/" . . . "https://box.everest.psnc.pl/f/67b5ddc8a3ac4047b3ef/" . . . "https://box.everest.psnc.pl/f/421adc4b01b24d2a906c/" . . . "https://box.everest.psnc.pl/f/421adc4b01b24d2a906c/" . . . "https://box.everest.psnc.pl/f/67b5ddc8a3ac4047b3ef/" . . . . "standard deviation of backscatter" . . "transports" . . "elaborate ASCII file" . . "produce a graph" . "SinkTrack It" . . . "statistics" . . "angle" . . "standard deviation" . . "graph" . . "ASCII file" . . "net" . . "depth" . . "angle of net" . . "ping" . . "net" . . "graph with the track" . . "statistics" . . "backscattering" . . "angle of net" . . "FM Midwater" . "service-account-enrichment" . . "http://ever-est.eu/value#/sinktrack" . "http://ever-est.eu/value#0226e45d-59ef-45dd-992f-824a0dbff431" . "http://ever-est.eu/value#Work" . "10.24424/ro-id.EHMJMDN68Q" . . "2019-12-09T08:16:15.705+01:00" . "http://everest.psnc.pl/users/antonio.petrizzo" . "http://sandbox.rohub.org/rodl/ROs/sinktrack/" . "http://w3id.org/ro-id/rohub/model#change_specifications/5ef61e03-1c33-483b-9abc-e527bc6ab6be" . "An ASCII file with beam time series extracted from the water column data, output of FM Midwater, is imported in Matlab where it is read and adpated to be further processed. The noise is filtered setting a threshold for the intensity values. Then the pings are stacked with the all values of the water column backscatter intensity for all beams over time. A graph with the track of the net, pings vs depth, and some statistics (mean and standard deviation of backscatter, depth, angle of net for each ping) are provided as output. The RO consists of three different workflows created through the Taverna Workbench Enterprise application and they are supposed to be run sequentially (“SinkTrackRead”, \"sinkTrackGraph\", \"SinkTrack\")." . . "18252"^^ . "https://api.rohub.org/api/ros/7bc38514-796e-47e6-81cb-b8f91247a854/crate/download/" . . "2019-12-09 07:16:15.705000+00:00" . "2025-03-05 01:19:05.791030+00:00" . "2019-12-09 07:16:15.705000+00:00" . "It reads and elaborates ASCII file produced with FM Midwater in order to calculate some statistics, mean, standard deviation of backscatter, depth, angle of net for each ping, and to produce a graph with the track of the net" . "application/ld+json" . "EASME/EMFF/2017/1.2.1.12/S2/05/SI2.789314" . . . . . "https://w3id.org/ro-id/7bc38514-796e-47e6-81cb-b8f91247a854" . "MarGnet, net, sinking velocity, water column, backscatter" . . "SinkTrack" . "Sea Monitoring" . . . . . "http://sandbox.rohub.org/rodl/ROs/sinktrack-release/" . "https://w3id.org/ro-id/7bc38514-796e-47e6-81cb-b8f91247a854" . "Aleksandra Kruss (ISMAR-CNR Venice), Antonio Petrizzo (ISMAR-CNR Venice), and Fantina Madricardo (ISMAR-CNR Venice). \"SinkTrack.\" ROHub. Dec 09 ,2019. https://doi.org/10.24424/ro-id.EHMJMDN68Q." . "produced" . . . "web services" . . . . . . "main" . . . "components" . . . "software" . . . . . "datasets" . . . "inputs" . . . . . . . "config" . . . "setup" . . . . . . "workflows" . . . "scripts" . . . . . "biblio" . . . "results" . . . "nested" . . . "used" . . . . "105094 KB" . "https://box.everest.psnc.pl/f/2a521bb3de8345b1ae9b/" . . "2022-03-24 13:29:20.753711+00:00" . "2022-03-24 13:29:22.977211+00:00" . "text/plain" . . "sinkTrackGraph1.t2flow" . "2022-03-24 13:29:20.753711+00:00" . . . . . "105100 KB" . "https://box.everest.psnc.pl/f/421adc4b01b24d2a906c/" . . "2022-03-24 13:29:20.753264+00:00" . "2022-03-24 13:29:22.867495+00:00" . "text/plain" . . "sinkTrackRead.t2flow" . "2022-03-24 13:29:20.753264+00:00" . . . . . "111274 KB" . "https://box.everest.psnc.pl/f/67b5ddc8a3ac4047b3ef/" . . "2022-03-24 13:29:20.754047+00:00" . "2022-03-24 13:29:22.725044+00:00" . "text/plain" . . "sinkTrack.t2flow" . "2022-03-24 13:29:20.754047+00:00" . . . . . . . "service-account-generation-service" . . . "2026-05-19T13:47:23.791+02:00"^^ . . . . . "SinkTrack" . "RSA" . "MIIBIjANBgkqhkiG9w0BAQEFAAOCAQ8AMIIBCgKCAQEAxszSDYX5tuCSkP7UiCtftYPFNQVTjgNu0I5fwdML2DLRDlp0xzmsQXRk8oHuvwGvG1aMjj6cpUqO+0rz2Sg/wvHOgUpkRH8VJXvmlkhafMLCMtUtk5JIx7e+fkzCby+fnmD7kMkGLrT+OaExWwEDmNlCAt0TPKcHSdwsjso2isXjtAsGevyCMke8ufnFYpjs746JES1eNzVnHnn2Kp/lqcm60GM+J8dLgRZp7fX0anW098xhKym6+xXFzqeju0vYRIHBPerv+r7skWxwk+a7Sd8msqVeYEv6NTqnyWvyWb6Yh8cvj04N6qm/T6C5FUPLQhzSaQgMVMU6yLqjPuu9DwIDAQAB" . "JR5eIYeHw1STCszWC1sKL3buIvdA04IXLYUe+vCmtJkQUS0/bp33mhaYCp9uDkqUHtrPEtdbbHMG4wwCu5jNBHXg51rJeWxRYvxDP1Qe9vtsIHb4Ght/niTfe1QksoCpkvj1QYkb70mjM5Lzjar/bcTWU5gPJZfvfw8lxJj0L/JKerZtGR6h7Xne9Xk5BMRMYboHC1Fq30bVgQKJIakgQapOYaBdUK2u+H3ExyDuUEiAjdotVMQDDU7QpDEAU2atrSCnmJKJo45eeLsezOclQx3sSxih8HyWc51olpu9lr7agYFVLkriIW1FaTrbBG8Odlqy8BIIniu3GFA09vbZQQ==" . . . . . . . "Antonio Petrizzo" . . "http://sandbox.rohub.org/rodl/ROs/sinktrack_FORK/" . "Matlab, Taverna, Linux environment" . . . "http://w3id.org/ro-id/rohub/model#change_specifications/bb9cdc2c-73eb-4d80-800e-664c1275dc70/changes/0153bea4-5f13-4ee7-b702-3df1e9e6af6c" . "http://w3id.org/ro-id/rohub/model#change_specifications/bb9cdc2c-73eb-4d80-800e-664c1275dc70/changes/056b9f5e-da5c-4242-b388-84a45f9d08f3" . "http://w3id.org/ro-id/rohub/model#change_specifications/bb9cdc2c-73eb-4d80-800e-664c1275dc70/changes/414dbcbc-a673-41eb-882b-c9f804c97458" . "http://w3id.org/ro-id/rohub/model#change_specifications/bb9cdc2c-73eb-4d80-800e-664c1275dc70/changes/8ef9d8c4-ff4b-44ea-8270-d4d3534f3331" . "http://w3id.org/ro-id/rohub/model#change_specifications/bb9cdc2c-73eb-4d80-800e-664c1275dc70/changes/9e6e3487-2529-449d-a7f4-3865e8f95705" . "http://w3id.org/ro-id/rohub/model#change_specifications/bb9cdc2c-73eb-4d80-800e-664c1275dc70/changes/f19400a3-8818-4a77-9170-9ddda31bee7a" . . "https://box.everest.psnc.pl/f/67b5ddc8a3ac4047b3ef/" . . . "https://box.everest.psnc.pl/f/2a521bb3de8345b1ae9b/" . . . "https://box.everest.psnc.pl/f/2a521bb3de8345b1ae9b/" . . . "https://box.everest.psnc.pl/f/421adc4b01b24d2a906c/" . . . "https://box.everest.psnc.pl/f/421adc4b01b24d2a906c/" . . . "https://box.everest.psnc.pl/f/67b5ddc8a3ac4047b3ef/" . . . . "standard deviation of backscatter" . . "transports" . . "elaborate ASCII file" . . "produce a graph" . "SinkTrack It" . . . "statistics" . . "angle" . . "standard deviation" . . "graph" . . "ASCII file" . . "net" . . "depth" . . "angle of net" . . "ping" . . "net" . . "graph with the track" . . "statistics" . . "backscattering" . . "angle of net" . . "FM Midwater" . "service-account-enrichment" . . "http://ever-est.eu/value#/sinktrack" . "http://ever-est.eu/value#0226e45d-59ef-45dd-992f-824a0dbff431" . "http://ever-est.eu/value#Work" . "10.24424/ro-id.CGRSLQGW8A" . . "2019-12-09T08:14:43.199+01:00" . "http://everest.psnc.pl/users/antonio.petrizzo" . "http://sandbox.rohub.org/rodl/ROs/sinktrack/" . "http://w3id.org/ro-id/rohub/model#change_specifications/bb9cdc2c-73eb-4d80-800e-664c1275dc70" . "An ASCII file with beam time series extracted from the water column data, output of FM Midwater, is imported in Matlab where it is read and adpated to be further processed. The noise is filtered setting a threshold for the intensity values. Then the pings are stacked with the all values of the water column backscatter intensity for all beams over time. A graph with the track of the net, pings vs depth, and some statistics (mean and standard deviation of backscatter, depth, angle of net for each ping) are provided as output. The RO consists of three different workflows created through the Taverna Workbench Enterprise application and they are supposed to be run sequentially (“SinkTrackRead”, \"sinkTrackGraph\", \"SinkTrack\")." . . "18326"^^ . "https://api.rohub.org/api/ros/84eea92b-94f8-43ea-a9ee-ad57b832298f/crate/download/" . . "2019-12-09 07:14:43.199000+00:00" . "2025-03-05 01:19:06.321946+00:00" . "2019-12-09 07:14:43.199000+00:00" . "It reads and elaborates ASCII file produced with FM Midwater in order to calculate some statistics, mean, standard deviation of backscatter, depth, angle of net for each ping, and to produce a graph with the track of the net" . "application/ld+json" . "EASME/EMFF/2017/1.2.1.12/S2/05/SI2.789314" . . . . . "https://w3id.org/ro-id/84eea92b-94f8-43ea-a9ee-ad57b832298f" . "MarGnet, net, sinking velocity, water column, backscatter" . . "SinkTrack" . "Sea Monitoring" . . . . . "http://sandbox.rohub.org/rodl/ROs/sinktrack_ARCHIVE/" . "https://w3id.org/ro-id/84eea92b-94f8-43ea-a9ee-ad57b832298f" . "Aleksandra Kruss (ISMAR-CNR Venice), Antonio Petrizzo (ISMAR-CNR Venice), and Fantina Madricardo (ISMAR-CNR Venice). \"SinkTrack.\" ROHub. Dec 09 ,2019. https://doi.org/10.24424/ro-id.CGRSLQGW8A." . "components" . . . "results" . . . . . "biblio" . . . . . . "main" . . . "scripts" . . . "setup" . . . "software" . . . "inputs" . . . "nested" . . . "produced" . . . "web services" . . . . . . "workflows" . . . . . . . "config" . . . . . "datasets" . . . "used" . . . . "105100 KB" . "https://box.everest.psnc.pl/f/421adc4b01b24d2a906c/" . . "2022-03-24 13:29:33.236065+00:00" . "2022-03-24 13:29:36.949488+00:00" . "text/plain" . . "sinkTrackRead.t2flow" . "2022-03-24 13:29:33.236065+00:00" . . . . . "111274 KB" . "https://box.everest.psnc.pl/f/67b5ddc8a3ac4047b3ef/" . . "2022-03-24 13:29:33.236597+00:00" . "2022-03-24 13:29:36.849067+00:00" . "text/plain" . . "sinkTrack.t2flow" . "2022-03-24 13:29:33.236597+00:00" . . . . . "105094 KB" . "https://box.everest.psnc.pl/f/2a521bb3de8345b1ae9b/" . . "2022-03-24 13:29:33.237122+00:00" . "2022-03-24 13:29:37.076804+00:00" . "text/plain" . . "sinkTrackGraph1.t2flow" . "2022-03-24 13:29:33.237122+00:00" . . . . . . . "service-account-generation-service" . . . "2026-05-19T13:47:23.496+02:00"^^ . . . . . "SinkTrack" . "RSA" . "MIIBIjANBgkqhkiG9w0BAQEFAAOCAQ8AMIIBCgKCAQEAxszSDYX5tuCSkP7UiCtftYPFNQVTjgNu0I5fwdML2DLRDlp0xzmsQXRk8oHuvwGvG1aMjj6cpUqO+0rz2Sg/wvHOgUpkRH8VJXvmlkhafMLCMtUtk5JIx7e+fkzCby+fnmD7kMkGLrT+OaExWwEDmNlCAt0TPKcHSdwsjso2isXjtAsGevyCMke8ufnFYpjs746JES1eNzVnHnn2Kp/lqcm60GM+J8dLgRZp7fX0anW098xhKym6+xXFzqeju0vYRIHBPerv+r7skWxwk+a7Sd8msqVeYEv6NTqnyWvyWb6Yh8cvj04N6qm/T6C5FUPLQhzSaQgMVMU6yLqjPuu9DwIDAQAB" . "AyUyh/I17o+0lHxG2qdwjm4mMvRRwRrTjtX7qYFrpAF8orlB82meQVtP2NZED7J1OHEYg6aeRa7RO7LcMPqq1/R2x5SZ0E40v8/2F5aW8Es7SwCYistm+BG/LVBDIEBG8VzN5cEW+eTmlhwyLNY5g+yIMejCzE8lviw2p9FAh4LZmZDMo2OQwJbH5osN4JX3W+8M7WwY08XJJXj9VtGcrKgP+uoFy5pYzhmW1OzxsSKvsj5NSHz9yc4OA+1UlOy1ZLdPnr2ObbF6Oq97MxC1lnmeU0dmkYZAFbhujFPXui5UCbse334/sKkdrCnG/Xb3a8N7ocpT1E6xQwYl8hY0xg==" . . . . . . . "Antonio Petrizzo" . . "Antonio Petrizzo (ISMAR-CNR)" . "Matlab, Taverna, Linux environment" . . . "http://w3id.org/ro-id/rohub/model#change_specifications/bded69c5-cf1d-4133-881c-9a6b0910abeb/changes/119ac5c2-463b-4ede-be70-cc579609a602" . "http://w3id.org/ro-id/rohub/model#change_specifications/bded69c5-cf1d-4133-881c-9a6b0910abeb/changes/6c63d6b6-05a9-4384-b76f-bbf4317339d8" . "http://w3id.org/ro-id/rohub/model#change_specifications/bded69c5-cf1d-4133-881c-9a6b0910abeb/changes/74ce7a8a-fc42-4ccf-b6f9-5a8475997af9" . "http://w3id.org/ro-id/rohub/model#change_specifications/bded69c5-cf1d-4133-881c-9a6b0910abeb/changes/7b28d672-9760-4db0-bff1-acff17898381" . "http://w3id.org/ro-id/rohub/model#change_specifications/bded69c5-cf1d-4133-881c-9a6b0910abeb/changes/815809d7-4c1a-4970-a4d9-6c6c0f056f9c" . "http://w3id.org/ro-id/rohub/model#change_specifications/bded69c5-cf1d-4133-881c-9a6b0910abeb/changes/a8984f97-b3e3-45fb-9868-ec2aade61d47" . "http://w3id.org/ro-id/rohub/model#change_specifications/bded69c5-cf1d-4133-881c-9a6b0910abeb/changes/a98bc604-d7ed-4d40-bb4e-6f75f9c604fc" . "http://w3id.org/ro-id/rohub/model#change_specifications/bded69c5-cf1d-4133-881c-9a6b0910abeb/changes/e340790a-bc79-422b-a5f5-a86a43f9b1c1" . . "https://box.everest.psnc.pl/f/da8ec060b9d84acbb927/" . . . "https://box.everest.psnc.pl/f/26ebe24c79a341dab257/" . . . "https://box.everest.psnc.pl/f/5c10551086ec469fab48/" . . . "https://box.everest.psnc.pl/f/ffc720db2af44b84bbe3/" . . . "https://box.everest.psnc.pl/f/5c10551086ec469fab48/" . . . "https://box.everest.psnc.pl/f/ffc720db2af44b84bbe3/" . . . "https://box.everest.psnc.pl/f/26ebe24c79a341dab257/" . . . "https://box.everest.psnc.pl/f/da8ec060b9d84acbb927/" . . . . "start from water column data" . . "sink velocity of a net" . . "thermohydraulics" . . "velocity" . . "net" . "service-account-enrichment" . . "http://ever-est.eu/value#/sinkvel" . "http://ever-est.eu/value#0226e45d-59ef-45dd-992f-824a0dbff431" . "http://ever-est.eu/value#Work" . "10.24424/ro-id.IKMY8URJ9Q" . . "2019-12-06T12:11:06.653+01:00" . "http://everest.psnc.pl/users/antonio.petrizzo" . "http://sandbox.rohub.org/rodl/ROs/sinkvel/" . "http://w3id.org/ro-id/rohub/model#change_specifications/bded69c5-cf1d-4133-881c-9a6b0910abeb" . "An ASCII file with beam time series extracted from the water column data, output of FM Midwater, is imported in Matlab where it is read and adpated to be further processed. The signal of the seafloor is identified and removed and the noise is filtered setting a threshold for the intensity values. Then the pings are stacked with the values of the water column backscatter intensity for each beam over time. Observing the point with higher intensity it is possible to reconstruct the path of the ML type within the specified beam. To estimate the sinking velocity a portion of the stacked pings is selected on the basis of the minimum and maximum number of pings and depths extracted with FM Midwater when the ASCII files where created. The selected window corresponds to the time interval when the ML is freely falling in the water column. The first input asks for a link to a .zip file containing the ASCII .txt data of the water column backscatter intensity values extracted with FM Midwater and a .inp file containing the values of the window used to calculate the sinking velocity. The second input (“working_dir”) is need only to specify the work directory when workin in a local machine." . . "20786"^^ . "https://api.rohub.org/api/ros/f8a252e5-47da-410b-9096-526bc50d19a3/crate/download/" . . "2019-12-06 11:11:06.653000+00:00" . "2025-03-05 01:19:06.823521+00:00" . "2019-12-06 11:11:06.653000+00:00" . "It calculates the sink velocity of a net floating in water starting from water column data." . "application/ld+json" . "EASME/EMFF/2017/1.2.1.12/S2/05/SI2.789314" . . . . . . "https://w3id.org/ro-id/f8a252e5-47da-410b-9096-526bc50d19a3" . "MarGnet, net, sink velocity, water column, backscatter" . . "SinkVel" . "information" . "net" . "sink" . "velocity" . "water column" . "water" . "earth sciences" . "data" . "net" . "sink" . "velocity" . "water column" . "water" . "engineering" . "float in water" . "sink velocity of a net" . "sink velocity" . "velocity of a net" . "water column data" . "It calculates the sink velocity of a net floating in water starting from water column data." . "SinkVel." . "Sea Monitoring" . . . . . "https://w3id.org/ro-id/f8a252e5-47da-410b-9096-526bc50d19a3" . "thermohydraulics" . "Aleksandra Kruss (ISMAR-CNR Venice), Antonio Petrizzo (ISMAR-CNR Venice), Fantina Madricardo (ISMAR-CNR Venice), and Lukasz Janowski (University of Gdansk). \"SinkVel.\" ROHub. Dec 06 ,2019. https://doi.org/10.24424/ro-id.IKMY8URJ9Q." . . "main" . . . . . . . "config" . . . . "results" . . . "web services" . . . . . . "workflows" . . . . . "datasets" . . . "software" . . . "used" . . . . "inputs" . . . "nested" . . . . . "biblio" . . . "scripts" . . . "components" . . . "produced" . . . "setup" . . . . "45619 B" . "https://box.everest.psnc.pl/f/ffc720db2af44b84bbe3/" . . "2022-03-24 13:29:52.552114+00:00" . "2022-03-24 13:29:55.959020+00:00" . "image/png" . . "sinkVel_a.png" . "2022-03-24 13:29:52.552114+00:00" . . . . . "48521 KB" . "https://box.everest.psnc.pl/f/5c10551086ec469fab48/" . . "2022-03-24 13:29:52.551666+00:00" . "2022-03-24 13:29:56.249419+00:00" . "Exemple of output" . "application/zip" . . "results.zip" . "2022-03-24 13:29:52.551666+00:00" . . . . . "102628 KB" . "https://box.everest.psnc.pl/f/26ebe24c79a341dab257/" . . "2022-03-24 13:29:52.551183+00:00" . "2022-03-24 13:29:56.066513+00:00" . "text/plain" . . "sinkVel.t2flow" . "2022-03-24 13:29:52.551183+00:00" . . . . . "7338044 KB" . "https://box.everest.psnc.pl/f/da8ec060b9d84acbb927/" . . "2022-03-24 13:29:52.552700+00:00" . "2022-03-24 13:29:56.799060+00:00" . "Input file for the workflow" . "application/zip" . . "myInput.zip" . "2022-03-24 13:29:52.552700+00:00" . . . . . . . "service-account-generation-service" . . . "2026-05-19T13:47:23.197+02:00"^^ . . . . . "SinkVel" . "RSA" . "MIIBIjANBgkqhkiG9w0BAQEFAAOCAQ8AMIIBCgKCAQEAxszSDYX5tuCSkP7UiCtftYPFNQVTjgNu0I5fwdML2DLRDlp0xzmsQXRk8oHuvwGvG1aMjj6cpUqO+0rz2Sg/wvHOgUpkRH8VJXvmlkhafMLCMtUtk5JIx7e+fkzCby+fnmD7kMkGLrT+OaExWwEDmNlCAt0TPKcHSdwsjso2isXjtAsGevyCMke8ufnFYpjs746JES1eNzVnHnn2Kp/lqcm60GM+J8dLgRZp7fX0anW098xhKym6+xXFzqeju0vYRIHBPerv+r7skWxwk+a7Sd8msqVeYEv6NTqnyWvyWb6Yh8cvj04N6qm/T6C5FUPLQhzSaQgMVMU6yLqjPuu9DwIDAQAB" . "WEI97xnCVKEVelNKhs8uapZPiVOIdqlMQj7j9DdYWIoRgbZ8Bs1T0yAZE1LdL5SOnUEiZisevf17ouKUO+/VY7fiiatZRbxwTu2YIsow0sYuof3r6UmG05JWcCyg+I5VG4dRF65IXrbGuNsvWq2W1ecotJEqv6JUoFPBvFTo/G7ne43oZ0DkQprioGitUy7RmSns61mZ3eqjN2MfY29hNpLamK4sp+b7ezL/kADltEj0g/wcumAuwI8iycgemBzQN8Y7fMxe0njHaiU6JnyMeNOdz8tJDh6O5JYOTT3Tw/nhvzcKhXYvZJWne/9f3QlyIZqWOSyoVikwBD+LjBTgDg==" . . . . . . . "Antonio Petrizzo" . . "Matlab, Taverna, Linux environment" . . . "http://sandbox.rohub.org/rodl/ROs/sinktrack/" . . . "standard deviation of backscatter" . . "transports" . . "elaborate ASCII file" . . "produce a graph" . "SinkTrack It" . . . "statistics" . . "angle" . . "standard deviation" . . "graph" . . "ASCII file" . . "net" . . "depth" . . "angle of net" . . "ping" . . "net" . . "graph with the track" . . "statistics" . . "backscattering" . . "angle of net" . . "FM Midwater" . "service-account-enrichment" . . "http://ever-est.eu/value#/sinktrack" . "http://ever-est.eu/value#0226e45d-59ef-45dd-992f-824a0dbff431" . "http://ever-est.eu/value#Work" . . "An ASCII file with beam time series extracted from the water column data, output of FM Midwater, is imported in Matlab where it is read and adpated to be further processed. The noise is filtered setting a threshold for the intensity values. Then the pings are stacked with the all values of the water column backscatter intensity for all beams over time. A graph with the track of the net, pings vs depth, and some statistics (mean and standard deviation of backscatter, depth, angle of net for each ping) are provided as output. The RO consists of three different workflows created through the Taverna Workbench Enterprise application and they are supposed to be run sequentially (“SinkTrackRead”, \"sinkTrackGraph\", \"SinkTrack\")." . . "16462"^^ . "https://api.rohub.org/api/ros/ac013b9e-5f40-4fd1-98b8-b6159150c2bd/crate/download/" . . "2019-12-05 15:43:07.194000+00:00" . "2025-03-05 01:19:06.548263+00:00" . "2019-12-05 15:43:07.194000+00:00" . "It reads and elaborates ASCII file produced with FM Midwater in order to calculate some statistics, mean, standard deviation of backscatter, depth, angle of net for each ping, and to produce a graph with the track of the net" . "application/ld+json" . "EASME/EMFF/2017/1.2.1.12/S2/05/SI2.789314" . . . . . "https://w3id.org/ro-id/ac013b9e-5f40-4fd1-98b8-b6159150c2bd" . "MarGnet, net, sink velocity, water column, backscatter" . . "SinkTrack" . "Sea Monitoring" . . . . . . "http://sandbox.rohub.org/rodl/ROs/sinktrack/" . "Aleksandra Kruss (ISMAR-CNR Venice), Antonio Petrizzo (ISMAR-CNR Venice), and Fantina Madricardo (ISMAR-CNR Venice). \"SinkTrack.\" ROHub. Dec 05 ,2019. https://w3id.org/ro-id/ac013b9e-5f40-4fd1-98b8-b6159150c2bd." . . . "biblio" . . . "nested" . . . "inputs" . . . "web services" . . . "scripts" . . . "setup" . . . . . . . "config" . . . . . "datasets" . . . "results" . . . "components" . . . "software" . . . "used" . . . "produced" . . . . . . "workflows" . . . . . . "main" . . . . "111274 KB" . "https://box.everest.psnc.pl/f/67b5ddc8a3ac4047b3ef/" . . "2022-03-24 13:30:11.012688+00:00" . "2022-03-24 13:30:12.439683+00:00" . "text/plain" . . "sinkTrack.t2flow" . "2022-03-24 13:30:11.012688+00:00" . . . . . "105100 KB" . "https://box.everest.psnc.pl/f/421adc4b01b24d2a906c/" . . "2022-03-24 13:30:11.013158+00:00" . "2022-03-24 13:30:12.285662+00:00" . "text/plain" . . "sinkTrackRead.t2flow" . "2022-03-24 13:30:11.013158+00:00" . . . . . "105094 KB" . "https://box.everest.psnc.pl/f/2a521bb3de8345b1ae9b/" . . "2022-03-24 13:30:11.013503+00:00" . "2022-03-24 13:30:12.231428+00:00" . "text/plain" . . "sinkTrackGraph1.t2flow" . "2022-03-24 13:30:11.013503+00:00" . . . . . . . "service-account-generation-service" . . . "2026-05-19T13:47:22.893+02:00"^^ . . . . . "SinkTrack" . "RSA" . "MIIBIjANBgkqhkiG9w0BAQEFAAOCAQ8AMIIBCgKCAQEAxszSDYX5tuCSkP7UiCtftYPFNQVTjgNu0I5fwdML2DLRDlp0xzmsQXRk8oHuvwGvG1aMjj6cpUqO+0rz2Sg/wvHOgUpkRH8VJXvmlkhafMLCMtUtk5JIx7e+fkzCby+fnmD7kMkGLrT+OaExWwEDmNlCAt0TPKcHSdwsjso2isXjtAsGevyCMke8ufnFYpjs746JES1eNzVnHnn2Kp/lqcm60GM+J8dLgRZp7fX0anW098xhKym6+xXFzqeju0vYRIHBPerv+r7skWxwk+a7Sd8msqVeYEv6NTqnyWvyWb6Yh8cvj04N6qm/T6C5FUPLQhzSaQgMVMU6yLqjPuu9DwIDAQAB" . "oQChlv50T8A2oRm6A6sfY6amgohYf/IrNC3rgRHk9oeC+OOC2Fg/CtSDeHOGaId4xNGQuvon04pBL5o43+DhFBK27P6U1WdqTvsAIRNGxR2Xgzl9UG70CX/sG7FJOivl6iwaNnvJEUvy4Miu6OLOFYStsVfTMA7Y2F13lMcHdASGpJDQ6EYYNn7r/WK4WXLVj/J5EkEQlM3CW2fePVwY2IO8my1M+MeKGZ6aqVPcViJ/9HCm3mvWFL5B69zNwV9VOmI/phJbZ6SYKKFitxYMr7U5IltWJ9nXJzig0IwX7Vj/OaQRaD3nR2hUkuC6xAGEhMVYO/1NPwWsnDo4uc4KdQ==" . . .